Western Blot (WB)
(Western Blot detection against Immunogen (56.91kD).)
Mouse anti-Human CLEC1A Monoclonal Antibody | anti-CLEC1A antibody
CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
CLEC1A; Monoclonal Antibody; CLEC1A (C-type Lectin Domain Family 1 Member A; C-type Lectin-like Receptor 1; CLEC-1; CLEC1; UNQ569/PRO1131; MGC34328); Anti -CLEC1A (C-type Lectin Domain Family 1 Member A; anti-CLEC1A antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F7
Specificity
Recognizes human CLEC1A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPRTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
Applicable Applications for anti-CLEC1A antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-281 from human CLEC1A (AAH39072) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (56.91kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (56.91kD).)
Testing Data
(Detection limit for recombinant GST tagged CLEC1A is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CLEC1A is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-CLEC1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,094 Da
NCBI Official Full Name
C-type lectin domain family 1 member A
NCBI Official Synonym Full Names
C-type lectin domain family 1, member A<
NCBI Official Symbol
CLEC1A
NCBI Protein Information
C-type lectin domain family 1 member A; CLEC-1; C-type lectin-like receptor 1
UniProt Protein Name
C-type lectin domain family 1 member A
Protein Family
UniProt Gene Name
CLEC1A
UniProt Synonym Gene Names
CLEC1; CLEC-1
UniProt Entry Name
CLC1A_BOVIN
Uniprot Description
Subcellular location: Membrane; Single-pass type II membrane protein
Probable.
Sequence similarities: Contains 1 C-type lectin domain.
Research Articles on CLEC1A
Similar Products
Product Notes
The CLEC1A clec1a (Catalog #AAA6012046) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CLEC1A clec1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQAKYSSTRD MLDDDGDTTM SLHSQGSATT RHPEPRRTEH RAPSSTWRPV ALTLLTLCLV LLIGLAALGL LFFQYYQLSN TGQDTISQME ERLGNTSQEL QSLQVQNIKL AGSLQHVAEK LCRELYNKAG AHRCSPRTEQ WKWHGDNCYQ FYKDSKSWED CKYFCLSENS TMLKINKQED LEFAASQSYS EFFYSYWTGL LRPDSGKAWL WMDGTPFTSE LFHIIIDVTS PRSRDCVAIL NGMIFSKDCK ELKRCVCERR AGMVKPESLH VPPETLGEGD. It is sometimes possible for the material contained within the vial of "CLEC1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
