Mouse CLDN4 Monoclonal Antibody | anti-CLDN4 antibody

CLDN4 (Claudin 4, CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R) (MaxLight 490)

Cat. Num. AAA6205670

• Gene Names: CLDN4; CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
• Applications: Immunoprecipitation
• Purity: Purified
• Synonyms: CLDN4; Monoclonal Antibody; CLDN4 (Claudin 4; CPE-R; CPER; CPETR; CPETR1; WBSCR8; hCPE-R) (MaxLight 490); Claudin 4; hCPE-R; anti-CLDN4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 4A11
• Specificity: Recognizes CLDN4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-CLDN4 antibody: Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CLDN4 (NP_001296, 29aa-78aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-CLDN4 antibody

This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq]

Product Categories/Family for anti-CLDN4 antibody

Antibodies; Claudin

NCBI and Uniprot Product Information

• NCBI GI #: 4502877
• NCBI GeneID: 1364
• NCBI Accession #: NP_001296
• NCBI GenBank Nucleotide #: NM_001305.4
• UniProt Accession #: O14493
• Molecular Weight: 23 kDa
• NCBI Official Full Name: claudin-4
• NCBI Official Synonym Full Names: claudin 4
• NCBI Official Symbol: CLDN4
• NCBI Official Synonym Symbols: CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
• NCBI Protein Information: claudin-4; CPE-receptor; Clostridium perfringens enterotoxin receptor 1; Williams-Beuren syndrome chromosomal region 8 protein
• UniProt Protein Name: Claudin-4
• Protein Family: Claudin
• UniProt Gene Name: CLDN4
• UniProt Synonym Gene Names: CPER; CPETR1; WBSCR8; CPE-R
• UniProt Entry Name: CLD4_HUMAN

NCBI Description

The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013]

Uniprot Description

Claudin-4: Plays a major role in tight junction-specific obliteration of the intercellular space. CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the claudin family.

Protein type: Membrane protein, multi-pass; Cytoskeletal; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: tight junction; apicolateral plasma membrane; integral to plasma membrane; apical plasma membrane; basal plasma membrane; plasma membrane; lateral plasma membrane

Molecular Function: identical protein binding; transmembrane receptor activity; structural molecule activity

Biological Process: female pregnancy; response to progesterone stimulus; signal transduction; calcium-independent cell-cell adhesion