Mouse anti-Human CLDN12 Monoclonal Antibody | anti-CLDN12 antibody

CLDN12 (Claudin-12, Claudin 12)

Cat. Num. AAA641922

• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CLDN12; Monoclonal Antibody; CLDN12 (Claudin-12; Claudin 12); Anti -CLDN12 (Claudin-12; anti-CLDN12 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D8
• Specificity: Recognizes human CLDN12.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT

• Applicable Applications for anti-CLDN12 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Full-length recombinant corresponding to aa1-244 from CLDN12 (AAH36754) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CLDN12 is 0.3 ng/ml using MBS641922.)

Related Product Information for anti-CLDN12 antibody

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Product Categories/Family for anti-CLDN12 antibody

Antibodies; Abs to Claudin

NCBI and Uniprot Product Information

• NCBI GI #: 49065366
• NCBI GeneID: 9069
• UniProt Accession #: Q6FIF6; P56749
• Molecular Weight: 27,094 Da
• NCBI Official Full Name: CLDN12
• NCBI Official Synonym Full Names: claudin 12
• NCBI Official Symbol: CLDN12
• NCBI Protein Information: claudin-12
• UniProt Protein Name: Claudin
• Protein Family: Claudin
• UniProt Gene Name: CLDN12
• UniProt Entry Name: Q6FIF6_HUMAN

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is expressed in the inner ear and bladder epithelium, and it is over-expressed in colorectal carcinomas. This protein and claudin 2 are critical for vitamin D-dependent Ca2+ absorption between enterocytes. Multiple alternatively spliced transcript variants encoding the same protein have been found.[provided by RefSeq, Sep 2011]

Uniprot Description

Claudin-12: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Belongs to the claudin family.

Protein type: Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: tight junction; integral to membrane; lateral plasma membrane

Molecular Function: identical protein binding; structural molecule activity

Biological Process: intercellular junction assembly and maintenance; calcium-independent cell-cell adhesion