Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CLCN6 Monoclonal Antibody | anti-CLCN6 antibody

CLCN6 (Chloride Transport Protein 6, Chloride Channel Protein 6, ClC-6, KIAA0046) (MaxLight 650)

Gene Names
CLCN6; CLC-6
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLCN6; Monoclonal Antibody; CLCN6 (Chloride Transport Protein 6; Chloride Channel Protein 6; ClC-6; KIAA0046) (MaxLight 650); anti-CLCN6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H2
Specificity
Recognizes human CLCN6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CLCN6 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa770-868 from human CLCN6 (NM_001286; NP_001277.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTYEFLQARLRQHYQT
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for MBS648953 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for MBS648953 is 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence on HeLa cell using MBS648953 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence on HeLa cell using MBS648953 (10ug/ml).)
Related Product Information for anti-CLCN6 antibody
Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.
Product Categories/Family for anti-CLCN6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
97,289 Da
NCBI Official Full Name
chloride transport protein 6 isoform 1
NCBI Official Synonym Full Names
chloride channel, voltage-sensitive 6
NCBI Official Symbol
CLCN6
NCBI Official Synonym Symbols
CLC-6
NCBI Protein Information
chloride transport protein 6
UniProt Protein Name
Chloride transport protein 6
UniProt Gene Name
CLCN6
UniProt Synonym Gene Names
KIAA0046; ClC-6
UniProt Entry Name
CLCN6_HUMAN

Uniprot Description

Function: Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.

Subcellular location: Endosome membrane; Multi-pass membrane protein. Note: Detected in detergent-resistant lipid rafts. Ref.11

Tissue specificity: Testis, ovary, small intestine, brain and skeletal muscle. Low level expression in aortic and coronary vascular smooth muscle cells, and aortic endothelial cells. Isoform 3 is only detected in kidney. Ref.1 Ref.2 Ref.10

Post-translational modification: N-glycosylated on several asparagine residues. Ref.11

Miscellaneous: The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The presence of conserved gating glutamate residues is typical for family members that function as antiporters

By similarity.

Sequence similarities: Belongs to the chloride channel (TC 2.A.49) family. ClC-6/CLCN6 subfamily. [View classification]Contains 2 CBS domains.

Similar Products

Product Notes

The CLCN6 clcn6 (Catalog #AAA6221511) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLCN6 (Chloride Transport Protein 6, Chloride Channel Protein 6, ClC-6, KIAA0046) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLCN6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLCN6 clcn6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLCN6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.