Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse CLCA1 Monoclonal Antibody | anti-CLCA1 antibody

CLCA1 (Chloride Channel Regulator 1, CACC, CACC1, CLCRG1, FLJ95147, GOB5) (MaxLight 750)

Gene Names
CLCA1; CACC; GOB5; CACC1; CLCRG1; CaCC-1; hCLCA1; hCaCC-1
Applications
Western Blot
Purity
Purified
Synonyms
CLCA1; Monoclonal Antibody; CLCA1 (Chloride Channel Regulator 1; CACC; CACC1; CLCRG1; FLJ95147; GOB5) (MaxLight 750); Chloride Channel Regulator 1; GOB5; anti-CLCA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C4
Specificity
Recognizes CLCA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CLCA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CLCA1 (NP_001276, 677aa-776aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CLCA1 antibody
This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. [provided by RefSeq]
Product Categories/Family for anti-CLCA1 antibody
References
1. Profiling of differentially expressed proteins in stage IV Colorectal cancers with good and poor outcomes. Kim HJ, Kang UB, Lee H, Jung JH, Lee ST, Yu MH, Kim H, Lee C.J Proteomics. 2011 Dec 10.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100,226 Da
NCBI Official Full Name
calcium-activated chloride channel regulator 1
NCBI Official Synonym Full Names
chloride channel accessory 1
NCBI Official Symbol
CLCA1
NCBI Official Synonym Symbols
CACC; GOB5; CACC1; CLCRG1; CaCC-1; hCLCA1; hCaCC-1
NCBI Protein Information
calcium-activated chloride channel regulator 1; CLCA family member 1, chloride channel regulator; calcium-activated chloride channel family member 1; calcium-activated chloride channel protein 1; calcium-dependent chloride channel-1; chloride channel, cal
UniProt Protein Name
Calcium-activated chloride channel regulator 1
UniProt Gene Name
CLCA1
UniProt Synonym Gene Names
CACC1; hCLCA1; CaCC-1; hCaCC-1
UniProt Entry Name
CLCA1_HUMAN

Uniprot Description

CLCA1: May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Belongs to the CLCR family.

Protein type: Vesicle; Channel, chloride

Chromosomal Location of Human Ortholog: 1p22.3

Cellular Component: extracellular space; zymogen granule membrane; microvillus; integral to plasma membrane; plasma membrane

Molecular Function: chloride channel activity; metallopeptidase activity; metal ion binding

Biological Process: transport; calcium ion transport; chloride transport; proteolysis; transmembrane transport

Similar Products

Product Notes

The CLCA1 clca1 (Catalog #AAA6237692) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CLCA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLCA1 clca1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLCA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.