Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat CHRNB2 Monoclonal Antibody | anti-CHRNB2 antibody

CHRNB2 (Neuronal Acetylcholine Receptor Subunit beta-2) (MaxLight 650)

Gene Names
CHRNB2; EFNL3; nAChRB2
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHRNB2; Monoclonal Antibody; CHRNB2 (Neuronal Acetylcholine Receptor Subunit beta-2) (MaxLight 650); anti-CHRNB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C7
Specificity
Recognizes human CHRNB2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CHRNB2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-130 from human CHRNB2 (NP_000739.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CHRNB2 antibody
Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy.
Product Categories/Family for anti-CHRNB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,019 Da
NCBI Official Full Name
neuronal acetylcholine receptor subunit beta-2
NCBI Official Synonym Full Names
cholinergic receptor, nicotinic, beta 2 (neuronal)
NCBI Official Symbol
CHRNB2
NCBI Official Synonym Symbols
EFNL3; nAChRB2
NCBI Protein Information
neuronal acetylcholine receptor subunit beta-2; neuronal nicotinic acetylcholine receptor beta 2; acetylcholine receptor, nicotinic, beta 2 (neuronal); beta2 human neuronal nicotinic acetylcholine receptor; cholinergic receptor, nicotinic, beta polypeptid
UniProt Protein Name
Neuronal acetylcholine receptor subunit beta-2
UniProt Gene Name
CHRNB2
UniProt Entry Name
ACHB2_HUMAN

NCBI Description

Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy. [provided by RefSeq, Jul 2008]

Uniprot Description

nAChRB2: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in CHRNB2 are the cause of nocturnal frontal lobe epilepsy type 3 (ENFL3). ENFL3 is an autosomal dominant epilepsy characterized by nocturnal seizures with hyperkinetic automatisms and poorly organized stereotyped movements. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Beta- 2/CHRNB2 sub-subfamily.

Protein type: Channel, cation; Receptor, misc.; Channel, ligand-gated; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; integral to membrane; plasma membrane; cell junction; external side of plasma membrane

Molecular Function: protein heterodimerization activity; acetylcholine receptor activity; drug binding; nicotinic acetylcholine-activated cation-selective channel activity; acetylcholine binding; ligand-gated ion channel activity

Biological Process: response to nicotine; positive regulation of dopamine secretion; protein heterooligomerization; regulation of dendrite morphogenesis; behavioral response to nicotine; locomotory behavior; regulation of circadian sleep/wake cycle, non-REM sleep; sensory perception of pain; signal transduction; regulation of dopamine secretion; synaptic transmission, cholinergic; synaptic transmission; regulation of synaptic transmission, dopaminergic; smooth muscle contraction; sensory perception of sound; visual perception; conditioned taste aversion; calcium ion transport; positive regulation of B cell proliferation; visual learning; synaptic transmission involved in micturition; associative learning; regulation of circadian sleep/wake cycle, REM sleep; vestibulocochlear nerve development; regulation of action potential; B cell activation; regulation of dopamine metabolic process; positive regulation of synaptic transmission, dopaminergic; central nervous system projection neuron axonogenesis; negative regulation of action potential; learning; social behavior; optic nerve morphogenesis; response to cocaine; memory; neurological system process; membrane depolarization; response to ethanol; regulation of synaptogenesis; response to hypoxia; ion transport; cognition; lateral geniculate nucleus development

Disease: Epilepsy, Nocturnal Frontal Lobe, 3

Research Articles on CHRNB2

Similar Products

Product Notes

The CHRNB2 chrnb2 (Catalog #AAA6221476) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHRNB2 (Neuronal Acetylcholine Receptor Subunit beta-2) (MaxLight 650) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNB2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHRNB2 chrnb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHRNB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.