Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CHRNA9 is 0.03 ng/ml as a capture antibody.)

Mouse CHRNA9 Monoclonal Antibody | anti-CHRNA9 antibody

CHRNA9 (Cholinergic Receptor, Nicotinic, alpha 9, HSA243342, MGC142109, MGC142135, NACHRA9) (Biotin)

Gene Names
CHRNA9; NACHRA9; HSA243342
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CHRNA9; Monoclonal Antibody; CHRNA9 (Cholinergic Receptor; Nicotinic; alpha 9; HSA243342; MGC142109; MGC142135; NACHRA9) (Biotin); Cholinergic Receptor; NACHRA9; anti-CHRNA9 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
80000
Specificity
Recognizes CHRNA9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CHRNA9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CHRNA9 (NP_060051.2, 139aa-221aa) partial recombinant protein with GST tag.
Immunogen Sequence
YDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CHRNA9 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CHRNA9 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-CHRNA9 antibody
This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells. [provided by RefSeq]
Product Categories/Family for anti-CHRNA9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,807 Da
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-9
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 9 subunit
NCBI Official Symbol
CHRNA9
NCBI Official Synonym Symbols
NACHRA9; HSA243342
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-9
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-9
UniProt Gene Name
CHRNA9
UniProt Synonym Gene Names
NACHRA9; NACHR alpha-9
UniProt Entry Name
ACHA9_HUMAN

NCBI Description

This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. [provided by RefSeq, Feb 2012]

Uniprot Description

nAChRA9: Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma. May also regulate keratinocyte adhesion. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 9/CHRNA9 sub-subfamily.

Protein type: Channel, ligand-gated; Membrane protein, integral; Channel, cation; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: cell junction; cytosol; integral to plasma membrane; nicotinic acetylcholine-gated receptor-channel complex; plasma membrane; postsynaptic membrane

Molecular Function: acetylcholine binding; acetylcholine receptor activity; acetylcholine-gated cation channel activity; calcium channel activity; nicotinic acetylcholine-activated cation-selective channel activity

Biological Process: detection of mechanical stimulus involved in sensory perception of sound; elevation of cytosolic calcium ion concentration; inner ear morphogenesis; synaptic transmission; synaptic transmission, cholinergic

Research Articles on CHRNA9

Similar Products

Product Notes

The CHRNA9 chrna9 (Catalog #AAA6174761) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CHRNA9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHRNA9 chrna9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHRNA9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.