Mouse CHMP2B Monoclonal Antibody | anti-CHMP2B antibody

CHMP2B (Chromatin Modifying Protein 2B, CHMP2.5, DKFZp564O123, DMT1, VPS2-2, VPS2B) (MaxLight 750)

Cat. Num. AAA6237666

• Gene Names: CHMP2B; DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
• Applications: FLISA
• Purity: Purified
• Synonyms: CHMP2B; Monoclonal Antibody; CHMP2B (Chromatin Modifying Protein 2B; CHMP2.5; DKFZp564O123; DMT1; VPS2-2; VPS2B) (MaxLight 750); Chromatin Modifying Protein 2B; VPS2B; anti-CHMP2B antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: M1
• Specificity: Recognizes CHMP2B.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
• Sequence Length: 213

• Applicable Applications for anti-CHMP2B antibody: FLISA
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CHMP2B (AAH01553.1, 1aa-213aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-CHMP2B antibody

This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq]

Product Categories/Family for anti-CHMP2B antibody

Antibodies; Chromatin Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16306739
• NCBI GeneID: 25978
• NCBI Official Full Name: Chromatin modifying protein 2B
• NCBI Official Synonym Full Names: charged multivesicular body protein 2B
• NCBI Official Symbol: CHMP2B
• NCBI Official Synonym Symbols: DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
• NCBI Protein Information: charged multivesicular body protein 2b
• Protein Family: Charged multivesicular body protein

NCBI Description

This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008]