Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.42kD).)

Mouse anti-Human CHD3 Monoclonal Antibody | anti-CHD3 antibody

CHD3 (Chromodomain-helicase-DNA-binding Protein 3, CHD-3, ATP-dependent Helicase CHD3, Mi-2 Autoantigen 240kD Protein, Mi2-alpha, Zinc Finger Helicase, hZFH) (AP)

Gene Names
CHD3; ZFH; Mi-2a; SNIBCPS; Mi2-ALPHA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHD3; Monoclonal Antibody; CHD3 (Chromodomain-helicase-DNA-binding Protein 3; CHD-3; ATP-dependent Helicase CHD3; Mi-2 Autoantigen 240kD Protein; Mi2-alpha; Zinc Finger Helicase; hZFH) (AP); anti-CHD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E12
Specificity
Recognizes human CHD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
2000
Applicable Applications for anti-CHD3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1654-1741 from human CHD3 (NP_001005273) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.42kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.42kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CHD3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CHD3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-CHD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
chromodomain-helicase-DNA-binding protein 3 isoform 1
NCBI Official Synonym Full Names
chromodomain helicase DNA binding protein 3
NCBI Official Symbol
CHD3
NCBI Official Synonym Symbols
ZFH; Mi-2a; SNIBCPS; Mi2-ALPHA
NCBI Protein Information
chromodomain-helicase-DNA-binding protein 3
UniProt Protein Name
Chromodomain-helicase-DNA-binding protein 3
UniProt Gene Name
CHD3
UniProt Synonym Gene Names
CHD-3; hZFH
UniProt Entry Name
CHD3_HUMAN

NCBI Description

This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

CHD-3 iso3: Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Required for anchoring centrosomal pericentrin in both interphase and mitosis, for spindle organization and centrosome integrity. Central component of the nucleosome remodeling and histone deacetylase (NuRD) repressive complex. Interacts with TRIM28 and SERBP1. Interacts (via its C-terminal) with HABP4. Interacts with PCNT; the interaction regulates centrosome integrity. Widely expressed. Belongs to the SNF2/RAD54 helicase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Helicase; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: nucleoplasm; centrosome; intermediate filament cytoskeleton; cytoplasm; nucleolus; NuRD complex; nucleus

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; zinc ion binding; helicase activity; ATP binding

Biological Process: chromatin assembly or disassembly; regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent; centrosome organization and biogenesis; chromatin modification; spindle organization and biogenesis; DNA duplex unwinding

Research Articles on CHD3

Similar Products

Product Notes

The CHD3 chd3 (Catalog #AAA6130571) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHD3 (Chromodomain-helicase-DNA-binding Protein 3, CHD-3, ATP-dependent Helicase CHD3, Mi-2 Autoantigen 240kD Protein, Mi2-alpha, Zinc Finger Helicase, hZFH) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHD3 chd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.