Mouse anti-Human CETN1 Monoclonal Antibody | anti-Cetn1 antibody

CETN1 (Centrin-1, Caltractin Isoform 2, CEN1, CETN)

Cat. Num. AAA649729

• Gene Names: Cetn1; caltractin
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CETN1; Monoclonal Antibody; CETN1 (Centrin-1; Caltractin Isoform 2; CEN1; CETN); Anti -CETN1 (Centrin-1; anti-Cetn1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A6
• Specificity: Recognizes human CETN1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEK

• Applicable Applications for anti-Cetn1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-100 from human CETN1 (AAH29515) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of CETN1 expression in transfected 293T cell line by CETN1 monoclonal antibody.|Lane 1: CETN1 transfected lysate (19.6kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CETN1 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-Cetn1 antibody

Plays a fundamental role in microtubule-organizing center structure and function.

Product Categories/Family for anti-Cetn1 antibody

Antibodies; Abs to Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 76253942
• NCBI GeneID: 26369
• NCBI Accession #: NP_031619.3
• NCBI GenBank Nucleotide #: NM_007593.5
• UniProt Accession #: P41209; Q3V119; Q9D9G9; Q9DAL6
• Molecular Weight: 19,696 Da
• NCBI Official Full Name: centrin-1
• NCBI Official Synonym Full Names: centrin 1
• NCBI Official Symbol: Cetn1
• NCBI Official Synonym Symbols: caltractin
• NCBI Protein Information: centrin-1; testis-specific murine centrin
• UniProt Protein Name: Centrin-1
• Protein Family: Centrin
• UniProt Gene Name: Cetn1
• UniProt Synonym Gene Names: Calt
• UniProt Entry Name: CETN1_MOUSE

Uniprot Description

Function: Plays a fundamental role in microtubule-organizing center structure and function.

Subunit structure: Monomer

By similarity. Interacts with PIFO. Ref.5

Subcellular location: Cytoplasm › cytoskeleton › microtubule organizing center › centrosome. Note: Centrosome of interphase and mitotic cells.

Tissue specificity: Expressed exclusively in testis. Localizes to the caudal portion of spermatozoa in seminiferous tubule and epididymis. Ref.2

Developmental stage: First expressed at 14 days postpartum (dpp). Levels increase dramatically between 14 dpp and 17 dpp. Ref.2

Miscellaneous: Binds two moles of calcium per mole of protein

By similarity.

Sequence similarities: Belongs to the centrin family.Contains 4 EF-hand domains.