Mouse anti-Human, Mouse CER1 Monoclonal Antibody | anti-CER1 antibody

CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (Biotin)

Cat. Num. AAA6141155

• Gene Names: CER1; DAND4
• Reactivity: Human, Mouse
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CER1; Monoclonal Antibody; CER1 (Cerberus; Cerberus-related Protein; DAN Domain Family Member 4; DAND4) (Biotin); anti-CER1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E11
• Specificity: Recognizes human CER1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 267

• Applicable Applications for anti-CER1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa158-266 from human CER1 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen using 124874 (37.73kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of CER1 transfected lysate using 124874 and Protein A Magnetic Bead and immunoblotted with CER1 rabbit polyclonal antibody.)

Related Product Information for anti-CER1 antibody

Cytokine that may play a role in anterior neural induction and somite formation during embryogenesis in part through a BMP-inhibitory mechanism. Can regulate Nodal signaling during gastrulation as well as the formation and patterning of the primitive streak.

Product Categories/Family for anti-CER1 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 4885135
• NCBI GeneID: 9350
• NCBI Accession #: NP_005445
• NCBI GenBank Nucleotide #: NM_005454
• UniProt Accession #: O95813
• NCBI Official Full Name: cerberus
• NCBI Official Synonym Full Names: cerberus 1, DAN family BMP antagonist
• NCBI Official Symbol: CER1
• NCBI Official Synonym Symbols: DAND4
• NCBI Protein Information: cerberus
• UniProt Protein Name: Cerberus
• Protein Family: Cerberus
• UniProt Gene Name: CER1
• UniProt Synonym Gene Names: DAND4
• UniProt Entry Name: CER1_HUMAN

NCBI Description

This gene encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein (BMP) antagonists that can bind directly to BMPs and inhibit their activity. [provided by RefSeq, Jul 2008]

Uniprot Description

CER1: Cytokine that may play a role in anterior neural induction and somite formation during embryogenesis in part through a BMP-inhibitory mechanism. Can regulate Nodal signaling during gastrulation as well as the formation and patterning of the primitive streak. Belongs to the DAN family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 9p23-p22

Cellular Component: extracellular space; extracellular region

Molecular Function: morphogen activity; protein homodimerization activity; cytokine activity

Biological Process: BMP signaling pathway; anterior/posterior pattern formation; negative regulation of cell proliferation; nervous system development; negative regulation of activin receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; ureteric bud development; gastrulation; determination of dorsal identity; bone mineralization; cell migration involved in gastrulation; negative regulation of BMP signaling pathway; anterior/posterior axis specification