Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (60.17kD).)

Mouse anti-Human CDX2 Monoclonal Antibody | anti-CDX2 antibody

CDX2 (Homeobox Protein CDX-2, CDX-3, Caudal-type Homeobox Protein 2, CDX3) (FITC)

Gene Names
CDX2; CDX3; CDX-3; CDX2/AS
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDX2; Monoclonal Antibody; CDX2 (Homeobox Protein CDX-2; CDX-3; Caudal-type Homeobox Protein 2; CDX3) (FITC); anti-CDX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
1C7
Specificity
Recognizes human CDX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CDX2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-313 from human CDX2 (AAH14461.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (60.17kD).)

Western Blot (WB) (Western Blot detection against Immunogen (60.17kD).)

Western Blot (WB)

(CDX2 monoclonal antibody. Western Blot analysis of CDX2 expression in human parotid gland.)

Western Blot (WB) (CDX2 monoclonal antibody. Western Blot analysis of CDX2 expression in human parotid gland.)

Western Blot (WB)

(CDX2 monoclonal antibody, Western Blot analysis of CDX2 expression in COLO 320 HSR.)

Western Blot (WB) (CDX2 monoclonal antibody, Western Blot analysis of CDX2 expression in COLO 320 HSR.)

Testing Data

(Detection limit for recombinant GST tagged CDX2 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged CDX2 is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-CDX2 antibody
CDX2 is a caudal type homeobox gene that encodes an intestine-specific transcription factor that is expressed early in intestinal development and may be involved in the regulation of proliferation and differentiation of intestinal epithelial cells. It is expressed in the nuclei of epithelial cells throughout the intestine, from duodenum to rectum. The CDX2 protein is expressed in primary and metastatic colorectal carcinomas and has also been demonstrated in the intestinal metaplasia of the stomach and intestinal-type gastric cancer, while it is not expressed in the normal gastric mucosa. Studies have shown that CDX2 is superior marker compared to CK20.
Product Categories/Family for anti-CDX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
33,520 Da
NCBI Official Full Name
Homo sapiens caudal type homeobox 2, mRNA
NCBI Official Synonym Full Names
caudal type homeobox 2
NCBI Official Symbol
CDX2
NCBI Official Synonym Symbols
CDX3; CDX-3; CDX2/AS
NCBI Protein Information
homeobox protein CDX-2
Protein Family

NCBI Description

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis. [provided by RefSeq, Jan 2012]

Research Articles on CDX2

Similar Products

Product Notes

The CDX2 (Catalog #AAA6146439) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDX2 (Homeobox Protein CDX-2, CDX-3, Caudal-type Homeobox Protein 2, CDX3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDX2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.