Mouse CDX1 Monoclonal Antibody | anti-CDX1 antibody

CDX1 (Caudal Type Homeobox 1, MGC116915) (HRP)

Cat. Num. AAA6180959

• Applications: Immunofluorescence
• Purity: Purified
• Synonyms: CDX1; Monoclonal Antibody; CDX1 (Caudal Type Homeobox 1; MGC116915) (HRP); Caudal Type Homeobox 1; MGC116915; anti-CDX1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A3
• Specificity: Recognizes CDX1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CDX1 antibody: Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CDX1 (NP_001795, 126aa-215aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CDX1 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDX1 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-CDX1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 121114296
• NCBI GeneID: 1044
• NCBI Accession #: NP_001795
• NCBI GenBank Nucleotide #: NM_001804
• UniProt Accession #: P47902
• Molecular Weight: 28kDa
• NCBI Official Full Name: homeobox protein CDX-1
• NCBI Official Synonym Full Names: caudal type homeobox 1
• NCBI Official Symbol: CDX1
• NCBI Protein Information: homeobox protein CDX-1
• UniProt Protein Name: Homeobox protein CDX-1
• Protein Family: Homeobox protein
• UniProt Gene Name: CDX1

NCBI Description

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq, Jul 2008]

Uniprot Description

Plays a role in transcriptional regulation (PubMed:24623306). Involved in activated KRAS-mediated transcriptional activation of PRKD1 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the PRKD1 promoter in colorectal cancer (CRC) cells (PubMed:24623306). Could play a role in the terminal differentiation of the intestine.