Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human CDON Monoclonal Antibody | anti-CDON antibody

CDON (Cell Adhesion Molecule-related/Down-regulated by Oncogenes, CDO, MGC111524, ORCAM) (FITC)

Gene Names
CDON; CDO; CDON1; HPE11; ORCAM
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDON; Monoclonal Antibody; CDON (Cell Adhesion Molecule-related/Down-regulated by Oncogenes; CDO; MGC111524; ORCAM) (FITC); anti-CDON antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G12
Specificity
Recognizes human CDON.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1264
Applicable Applications for anti-CDON antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1155-1264 from human CDON (NP_058648) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)
Related Product Information for anti-CDON antibody
CDON and BOC (MIM 608708) are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII; see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.
Product Categories/Family for anti-CDON antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cell adhesion molecule-related/down-regulated by oncogenes isoform 2
NCBI Official Synonym Full Names
cell adhesion associated, oncogene regulated
NCBI Official Symbol
CDON
NCBI Official Synonym Symbols
CDO; CDON1; HPE11; ORCAM
NCBI Protein Information
cell adhesion molecule-related/down-regulated by oncogenes
UniProt Protein Name
Cell adhesion molecule-related/down-regulated by oncogenes
UniProt Gene Name
CDON
UniProt Synonym Gene Names
CDO
UniProt Entry Name
CDON_HUMAN

NCBI Description

This gene encodes a cell surface receptor that is a member of the immunoglobulin superfamily. The encoded protein contains three fibronectin type III domains and five immunoglobulin-like C2-type domains. This protein is a member of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells and positively regulates myogenesis. [provided by RefSeq, Aug 2011]

Uniprot Description

CDON: Component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells. Promotes differentiation of myogenic cells. Defects in CDON are the cause of holoprosencephaly type 11 (HPE11). HPE11 is a structural anomaly of the brain, in which the developing forebrain fails to correctly separate into right and left hemispheres. Holoprosencephaly is genetically heterogeneous and associated with several distinct facies and phenotypic variability. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11q24.2

Cellular Component: extracellular matrix; integral to membrane; plasma membrane

Molecular Function: protein binding

Biological Process: lens development in camera-type eye; regulation of protein heterodimerization activity; smoothened signaling pathway; satellite cell differentiation; cell fate specification; positive regulation of skeletal muscle development; anterior/posterior pattern formation; positive regulation of small GTPase mediated signal transduction; embryonic body morphogenesis; muscle cell differentiation; positive regulation of MAPKKK cascade; embryonic retina morphogenesis in camera-type eye; positive regulation of muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; cerebral cortex development; cell adhesion; positive regulation of neuron differentiation; myoblast fusion

Disease: Holoprosencephaly 11

Research Articles on CDON

Similar Products

Product Notes

The CDON cdon (Catalog #AAA6146435) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDON (Cell Adhesion Molecule-related/Down-regulated by Oncogenes, CDO, MGC111524, ORCAM) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDON can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDON cdon for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDON, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.