Mouse anti-Human, Rat CDK6 Monoclonal Antibody | anti-CDK6 antibody

CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (Biotin)

Cat. Num. AAA6141121

• Gene Names: CDK6; MCPH12; PLSTIRE
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDK6; Monoclonal Antibody; CDK6 (Cell Division Protein Kinase 6; Serine/Threonine-protein Kinase PLSTIRE; Crk2; MGC59692) (Biotin); anti-CDK6 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 8H4
• Specificity: Recognizes human CDK6. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CDK6 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa3-99 from human CDK6 (NP_001250) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB)

(Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody. Lane 1: CDK6 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CDK2 and CDK6 HeLa cells were stained with CDK2 rabbit purified polyclonal 1:1200 and CDK6 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(CDK6 monoclonal antibody. Western Blot analysis of CDK6 expression in PC-12.)

Western Blot (WB)

(CDK6 monoclonal antibody, Western Blot analysis of CDK6 expression in Jurkat.)

Product Categories/Family for anti-CDK6 antibody

Antibodies; Protein Kinases

References

1. APRIL promotes cell-cycle progression in primary multiple myeloma cells: influence of D-type cyclin group and translocation status. Quinn J, Glassford J, Percy L, Munson P, Marafioti T, Rodriguez-Justo M, Yong K.Blood. 2011 Jan 20;117(3):890-901. Epub 2010 Aug 13.

NCBI and Uniprot Product Information

• NCBI GI #: 4502741
• NCBI GeneID: 1021
• NCBI Accession #: NP_001250
• NCBI GenBank Nucleotide #: NM_001259
• UniProt Accession #: Q00534; A4D1G0
• Molecular Weight: 36,938 Da
• NCBI Official Full Name: cyclin-dependent kinase 6
• NCBI Official Synonym Full Names: cyclin-dependent kinase 6
• NCBI Official Symbol: CDK6
• NCBI Official Synonym Symbols: MCPH12; PLSTIRE
• NCBI Protein Information: cyclin-dependent kinase 6
• UniProt Protein Name: Cyclin-dependent kinase 6
• Protein Family: Cyclin-dependent kinase
• UniProt Gene Name: CDK6
• UniProt Synonym Gene Names: CDKN6
• UniProt Entry Name: CDK6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Expression of this gene is up-regulated in some types of cancer. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009]