Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CDC2L2 on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human CDK11A Monoclonal Antibody | anti-CDK11A antibody

CDK11A (Cyclin-dependent Kinase 11A, Cell Division Cycle 2-like Protein Kinase 2, Cell Division Protein Kinase 11A, Galactosyltransferase-associated Protein Kinase p58/GTA, PITSLRE Serine/Threonine-protein Kinase CDC2L2, CDC2L2, CDC2L3, PITSLREB) (Biotin)

Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDK11A; Monoclonal Antibody; CDK11A (Cyclin-dependent Kinase 11A; Cell Division Cycle 2-like Protein Kinase 2; Cell Division Protein Kinase 11A; Galactosyltransferase-associated Protein Kinase p58/GTA; PITSLRE Serine/Threonine-protein Kinase CDC2L2; CDC2L2; CDC2L3; PITSLREB) (Biotin); anti-CDK11A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A9
Specificity
Recognizes human CDC2L2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CDK11A antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
Sandwich ELISA: The detection limit is ~0.03ng/ml
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa681-780 from human CDC2L2 (NP_277073) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDC2L2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CDC2L2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CDC2L2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDC2L2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-CDK11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
Protein Family

Similar Products

Product Notes

The CDK11A (Catalog #AAA6141101) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDK11A (Cyclin-dependent Kinase 11A, Cell Division Cycle 2-like Protein Kinase 2, Cell Division Protein Kinase 11A, Galactosyltransferase-associated Protein Kinase p58/GTA, PITSLRE Serine/Threonine-protein Kinase CDC2L2, CDC2L2, CDC2L3, PITSLREB) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK11A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). Sandwich ELISA: The detection limit is ~0.03ng/ml IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDK11A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK11A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.