Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human CDH17 Monoclonal Antibody | anti-CDH17 antibody

CDH17 (LI Cadherin, Cadherin-17, Intestinal Peptide-associated Transporter HPT-1, Liver-intestine Cadherin) (MaxLight 650)

Gene Names
CDH17; HPT1; CDH16; HPT-1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDH17; Monoclonal Antibody; CDH17 (LI Cadherin; Cadherin-17; Intestinal Peptide-associated Transporter HPT-1; Liver-intestine Cadherin) (MaxLight 650); anti-CDH17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H3
Specificity
Recognizes human CDH17.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CDH17 antibody
FLISA, Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-131 from human CDH17 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(Western Blot analysis of CDH17 expression in human intestinal wall using 124767.)

Western Blot (WB) (Western Blot analysis of CDH17 expression in human intestinal wall using 124767.)

Immunohistochemistry (IHC)

(Immunoperoxidase of 124767 (3ug/ml) to CDH17 on formalin-fixed paraffin-embedded human small Intestine.)

Immunohistochemistry (IHC) (Immunoperoxidase of 124767 (3ug/ml) to CDH17 on formalin-fixed paraffin-embedded human small Intestine.)

Testing Data

(Detection limit for recombinant GST tagged CDH17 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDH17 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-CDH17 antibody
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.
Product Categories/Family for anti-CDH17 antibody
References
1. Comparison of cadherin-17 expression between primary colorectal adenocarcinomas and their corresponding metastases: the possibility of a diagnostic marker for detecting the primary site of metastatic tumour. Park JH, Seol JA, Choi HJ, Roh YH, Choi PJ, Lee KE, Roh MS.Histopathology. 2011 Jan;58(2):315-8. doi: 10.1111/j.1365-2559.2011.03746.x. 2. Cadherin-17 is a useful diagnostic marker for adenocarcinomas of the digestive system. Su MC, Yuan RH, Lin CY, Jeng YM.Mod Pathol. 2008 Nov;21(11):1379-86. Epub 2008 Jun 13.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92,219 Da
NCBI Official Full Name
cadherin-17
NCBI Official Synonym Full Names
cadherin 17
NCBI Official Symbol
CDH17
NCBI Official Synonym Symbols
HPT1; CDH16; HPT-1
NCBI Protein Information
cadherin-17
UniProt Protein Name
Cadherin-17
Protein Family
UniProt Gene Name
CDH17
UniProt Synonym Gene Names
LI-cadherin
UniProt Entry Name
CAD17_HUMAN

NCBI Description

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2009]

Uniprot Description

CDH17: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 8q22.1

Cellular Component: basolateral plasma membrane; integral to membrane; plasma membrane

Molecular Function: transporter activity; calcium ion binding; proton-dependent oligopeptide secondary active transmembrane transporter activity

Biological Process: intercellular junction assembly and maintenance; transport; calcium-dependent cell-cell adhesion; oligopeptide transport; homophilic cell adhesion; cell adhesion

Research Articles on CDH17

Similar Products

Product Notes

The CDH17 cdh17 (Catalog #AAA6221396) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDH17 (LI Cadherin, Cadherin-17, Intestinal Peptide-associated Transporter HPT-1, Liver-intestine Cadherin) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDH17 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDH17 cdh17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDH17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.