Mouse anti-Human CDC25C Monoclonal Antibody | anti-CDC25C antibody

CDC25C (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) (Biotin)

Cat. Num. AAA6141100

• Gene Names: CDC25C; CDC25; PPP1R60
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDC25C; Monoclonal Antibody; CDC25C (Cell Division Cycle 25 Homolog C; Cdc 25C; CDC 25; Dual Specificity Phosphatase Cdc25C; M-phase Inducer Phosphatase 3; MPIP3; PPP1R60) (Biotin); anti-CDC25C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B11
• Specificity: Recognizes human CDC25C.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CDC25C antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 6ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-130 from human CDC25C (AAH19089) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(CDC25C monoclonal antibody, Western Blot analysis of CDC25C expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of CDC25C expression in transfected 293T cell line by CDC25C monoclonal antibody. Lane 1: CDC25C transfected lysate (53.312kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDC25C on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CDC25C is ~0.1ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of CDC25C transfected lysate using CDC25C monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CDC25C rabbit polyclonal antibody.)

Western Blot (WB)

(Western blot analysis of CDC25C over-expressed 293 cell line, cotransfected with CDC25C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDC25C monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-CDC25C antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33877967
• NCBI GeneID: 995
• Molecular Weight: 45,608 Da
• NCBI Official Full Name: Homo sapiens cell division cycle 25 homolog C (S. pombe), mRNA
• NCBI Official Synonym Full Names: cell division cycle 25C
• NCBI Official Symbol: CDC25C
• NCBI Official Synonym Symbols: CDC25; PPP1R60
• NCBI Protein Information: M-phase inducer phosphatase 3

NCBI Description

This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015]