Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CDC2 monoclonal antibody (M04), clone 8F1 Western Blot analysis of CDC2 expression in Hela S3 NE (Cat # L013V3).)

Mouse CDC2 Monoclonal Antibody | anti-CDC2 antibody

CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (HRP)

Gene Names
CDK1; CDC2; CDC28A; P34CDC2
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
CDC2; Monoclonal Antibody; CDC2 (Cell Division Cycle 2; G1 to S and G2 to M; CDC28A; CDK1; DKFZp686L20222; MGC111195) (HRP); Cell Division Cycle 2; MGC111195; anti-CDC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
8F1
Specificity
Recognizes CDC2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
297
Applicable Applications for anti-CDC2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CDC2 (AAH14563, 211aa-297aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CDC2 monoclonal antibody (M04), clone 8F1 Western Blot analysis of CDC2 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (CDC2 monoclonal antibody (M04), clone 8F1 Western Blot analysis of CDC2 expression in Hela S3 NE (Cat # L013V3).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CDC2 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDC2 is approximately 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(CDC2 monoclonal antibody (M04), clone 8F1. Western Blot analysis of CDC2 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (CDC2 monoclonal antibody (M04), clone 8F1. Western Blot analysis of CDC2 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(CDC2 monoclonal antibody (M04), clone 8F1. Western Blot analysis of CDC2 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (CDC2 monoclonal antibody (M04), clone 8F1. Western Blot analysis of CDC2 expression in PC-12 (Cat # L012V1).)
Product Categories/Family for anti-CDC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
983
NCBI Official Full Name
Cell division cycle 2, G1 to S and G2 to M
NCBI Official Synonym Full Names
cyclin dependent kinase 1
NCBI Official Symbol
CDK1
NCBI Official Synonym Symbols
CDC2; CDC28A; P34CDC2
NCBI Protein Information
cyclin-dependent kinase 1
Protein Family

NCBI Description

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Research Articles on CDC2

Similar Products

Product Notes

The CDC2 (Catalog #AAA6179181) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CDC2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.