Mouse anti-Human CDC14A Monoclonal Antibody | anti-CDC14A antibody

CDC14A (Dual Specificity Protein Phosphatase CDC14A, CDC14 Cell Division Cycle 14 Homolog A) (Biotin)

Cat. Num. AAA6141094

• Gene Names: CDC14A; cdc14; DFNB32; DFNB35; hCDC14; DFNB105
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDC14A; Monoclonal Antibody; CDC14A (Dual Specificity Protein Phosphatase CDC14A; CDC14 Cell Division Cycle 14 Homolog A) (Biotin); anti-CDC14A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C12
• Specificity: Recognizes human CDC14A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CDC14A antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa431-530 from CDC14A (NP_003663) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CDC14A expression in transfected 293T cell line by CDC14A monoclonal antibody Lane 1: CDC14A transfected lysate (66.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDC14A on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CDC14A is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD))

Product Categories/Family for anti-CDC14A antibody

Antibodies; Cell Division Cycle (CDC)

NCBI and Uniprot Product Information

• NCBI GI #: 15451929
• NCBI GeneID: 8556
• NCBI Accession #: NP_003663
• NCBI GenBank Nucleotide #: NM_003672
• UniProt Accession #: Q9UNH5
• Molecular Weight: 66kDa
• NCBI Official Full Name: dual specificity protein phosphatase CDC14A isoform 1
• NCBI Official Synonym Full Names: cell division cycle 14A
• NCBI Official Symbol: CDC14A
• NCBI Official Synonym Symbols: cdc14; DFNB32; DFNB35; hCDC14; DFNB105
• NCBI Protein Information: dual specificity protein phosphatase CDC14A
• UniProt Protein Name: Dual specificity protein phosphatase CDC14A
• Protein Family: Dual specificity protein phosphatase
• UniProt Gene Name: CDC14A
• UniProt Entry Name: CC14A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, suggesting a role in cell cycle control. This protein has been shown to interact with, and dephosphorylate tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splicing of this gene results in several transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CDC14A: Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC- FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis. Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; EC 3.1.3.48; Protein phosphatase, dual-specificity; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 1p21

Cellular Component: nucleoplasm; centrosome; cytoplasm; spindle; nucleus

Molecular Function: protein binding; protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; phosphoprotein phosphatase activity

Biological Process: cell proliferation; cell division; cell cycle