Mouse anti-Human CD99 Monoclonal Antibody | anti-CD99 antibody

CD99 (CD99 Antigen, 12E7, E2 Antigen, Protein MIC2, T-cell Surface Glycoprotein E2, MIC2, MIC2X, MIC2Y) (FITC)

Cat. Num. AAA6146395

• Gene Names: CD99; MIC2; HBA71; MIC2X; MIC2Y; MSK5X
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD99; Monoclonal Antibody; CD99 (CD99 Antigen; 12E7; E2 Antigen; Protein MIC2; T-cell Surface Glycoprotein E2; MIC2; MIC2X; MIC2Y) (FITC); anti-CD99 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A10
• Specificity: Recognizes human CD99.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CD99 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa23-122 from human CD99 (AAH03147) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CD99 monoclonal antibody Western Blot analysis of CD99 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of CD99 expression in transfected 293T cell line by CD99 monoclonal antibody. Lane 1: CD99 transfected lysate (18.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CD99 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-CD99 antibody

CD99 or MIC2 gene product, or E2 antigen is expressed in the cell membrane of some lymphocytes, cortical thymocytes, and granulosa cells of the ovary. The antigen is also expressed by most pancreatic islet cells, Sertoli cells of the testis and some endothelial cells. Mature granulocytes express very little or no CD99. MIC2 is strongly expressed on Ewing's sarcoma cells and primitive peripheral neuroectodermal tumors.

Product Categories/Family for anti-CD99 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 13111948
• NCBI GeneID: 4267
• Molecular Weight: 17,128 Da
• NCBI Official Full Name: Homo sapiens CD99 molecule, mRNA
• NCBI Official Synonym Full Names: CD99 molecule
• NCBI Official Symbol: CD99
• NCBI Official Synonym Symbols: MIC2; HBA71; MIC2X; MIC2Y; MSK5X
• NCBI Protein Information: CD99 antigen
• Protein Family: CD99 antigen

NCBI Description

The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. [provided by RefSeq, Mar 2016]