Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CD84 Monoclonal Antibody | anti-CD84 antibody

CD84 (SLAM Family Member 5, Cell Surface Antigen MAX.3, Hly9-beta, Leukocyte Differentiation Antigen CD84, Signaling Lymphocytic Activation Molecule 5, SLAMF5, DKFZp781E2378) (PE)

Gene Names
CD84; LY9B; hCD84; mCD84; SLAMF5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD84; Monoclonal Antibody; CD84 (SLAM Family Member 5; Cell Surface Antigen MAX.3; Hly9-beta; Leukocyte Differentiation Antigen CD84; Signaling Lymphocytic Activation Molecule 5; SLAMF5; DKFZp781E2378) (PE); anti-CD84 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G10
Specificity
Recognizes human CD84.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CD84 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa22-122 from CD84 (NP_003865) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of CD84 expression in transfected 293T cell line by CD84 monoclonal antibody Lane 1: CD84 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD84 expression in transfected 293T cell line by CD84 monoclonal antibody Lane 1: CD84 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD84 antibody
CD84 is a 64-82kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of (preferentially on CD45RO+) T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. The antibody CD84.1.21 is able to enhance CD3 induced IFN-g production and partially block CD84-Ig binding to lymphocytes.
Product Categories/Family for anti-CD84 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,025 Da
NCBI Official Full Name
SLAM family member 5 isoform 2
NCBI Official Synonym Full Names
CD84 molecule
NCBI Official Symbol
CD84
NCBI Official Synonym Symbols
LY9B; hCD84; mCD84; SLAMF5
NCBI Protein Information
SLAM family member 5
UniProt Protein Name
SLAM family member 5
Protein Family
UniProt Gene Name
CD84
UniProt Synonym Gene Names
SLAMF5
UniProt Entry Name
SLAF5_HUMAN

NCBI Description

This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]

Uniprot Description

CD84: Plays a role as adhesion receptor functioning by homophilic interactions and by clustering. Recruits SH2 domain- containing proteins SH2D1A/SAP. Increases proliferative responses of activated T-cells and SH2D1A/SAP does not seen be required for this process. Homophilic interactions enhance interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A/SAP-dependent pathway. May serve as a marker for hematopoietic progenitor cells. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Cell surface; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: defense response; homophilic cell adhesion; blood coagulation; leukocyte migration

Research Articles on CD84

Similar Products

Product Notes

The CD84 cd84 (Catalog #AAA6156992) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD84 (SLAM Family Member 5, Cell Surface Antigen MAX.3, Hly9-beta, Leukocyte Differentiation Antigen CD84, Signaling Lymphocytic Activation Molecule 5, SLAMF5, DKFZp781E2378) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD84 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD84 cd84 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD84, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.