Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FCGR1A is ~1ng/ml as a capture antibody.)

Mouse anti-Human CD64 Monoclonal Antibody | anti-CD64 antibody

CD64 (High Affinity Immunoglobulin gamma Fc Receptor I, IgG Fc Receptor I, Fc-gamma RI, FcRI, Fc-gamma RIA, FcgammaRIa, FCGR1A, FCG1, FCGR1, IGFR1) (Biotin)

Gene Names
FCGR1A; CD64; FCRI; CD64A; IGFR1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD64; Monoclonal Antibody; CD64 (High Affinity Immunoglobulin gamma Fc Receptor I; IgG Fc Receptor I; Fc-gamma RI; FcRI; Fc-gamma RIA; FcgammaRIa; FCGR1A; FCG1; FCGR1; IGFR1) (Biotin); anti-CD64 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D3
Specificity
Recognizes human FCGR1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CD64 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa16-115 from human FCGR1A (NP_000557) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FCGR1A is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FCGR1A is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FCGR3A and FCGR1A. HeLa cells were stained with FCGR3A rabbit purified polyclonal 1:1200 and FCGR1A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FCGR3A and FCGR1A. HeLa cells were stained with FCGR3A rabbit purified polyclonal 1:1200 and FCGR1A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)
Related Product Information for anti-CD64 antibody
CD64 is a 72kD single chain type I glycoprotein also known as FcyRI and FcR I. CD64 is a member of the immunoglobulin superfamily and is expressed on monocytes/macrophages, dendritic cells, and activated granulocytes. The expression can be upregulated by IFN-y stimulation. CD64 binds IgG immune complex. It plays a role in antigen capture, phagocytosis of IgG/antigen complexes, and antibody-dependent cellular cytotoxicity (ADCC).
Product Categories/Family for anti-CD64 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,795 Da
NCBI Official Full Name
high affinity immunoglobulin gamma Fc receptor I
NCBI Official Synonym Full Names
Fc fragment of IgG receptor Ia
NCBI Official Symbol
FCGR1A
NCBI Official Synonym Symbols
CD64; FCRI; CD64A; IGFR1
NCBI Protein Information
high affinity immunoglobulin gamma Fc receptor I
UniProt Protein Name
High affinity immunoglobulin gamma Fc receptor I
UniProt Gene Name
FCGR1A
UniProt Synonym Gene Names
FCG1; FCGR1; IGFR1; IgG Fc receptor I; FcRI; FcgammaRIa
UniProt Entry Name
FCGR1_HUMAN

NCBI Description

This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq, Jul 2008]

Uniprot Description

FCGR1A: High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses. Belongs to the immunoglobulin superfamily. FCGR1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.2-q21.3

Cellular Component: early endosome membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; IgG binding; receptor signaling protein activity

Biological Process: antigen processing and presentation of peptide antigen via MHC class I; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; immune response; signal transduction; phagocytosis, engulfment

Research Articles on CD64

Similar Products

Product Notes

The CD64 fcgr1a (Catalog #AAA6141075) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD64 (High Affinity Immunoglobulin gamma Fc Receptor I, IgG Fc Receptor I, Fc-gamma RI, FcRI, Fc-gamma RIA, FcgammaRIa, FCGR1A, FCG1, FCGR1, IGFR1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD64 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD64 fcgr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD64, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.