Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human CD42b Monoclonal Antibody | anti-CD42b antibody

CD42b (Platelet Glycoprotein Ib alpha Chain, GP-Ib alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Antigen CD42b-alpha, GP1BA, MGC34595) (PE)

Gene Names
GP1BA; BSS; GP1B; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; GPIbalpha; CD42b-alpha
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD42b; Monoclonal Antibody; CD42b (Platelet Glycoprotein Ib alpha Chain; GP-Ib alpha; GPIb-alpha; GPIbA; Glycoprotein Ibalpha; Antigen CD42b-alpha; GP1BA; MGC34595) (PE); anti-CD42b antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C6
Specificity
Recognizes human GP1BA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CD42b antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa19-128 from human GP1BA (AAH27955) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of GP1BA transfected lysate using GP1BA monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GP1BA rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GP1BA transfected lysate using GP1BA monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GP1BA rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GP1BA is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GP1BA is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-CD42b antibody
CD42b is expressed on platelets and megakaryocytes. CD42b/c heterodimer forms a complex with CD42a and d and acts as the receptor for Von Willibrand factor and thrombin.
Product Categories/Family for anti-CD42b antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
71,540 Da
NCBI Official Full Name
Homo sapiens glycoprotein Ib (platelet), alpha polypeptide, mRNA
NCBI Official Synonym Full Names
glycoprotein Ib platelet alpha subunit
NCBI Official Symbol
GP1BA
NCBI Official Synonym Symbols
BSS; GP1B; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; GPIbalpha; CD42b-alpha
NCBI Protein Information
platelet glycoprotein Ib alpha chain

NCBI Description

Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that is linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Mutations in this gene result in Bernard-Soulier syndromes and platelet-type von Willebrand disease. The coding region of this gene is known to contain a polymophic variable number tandem repeat (VNTR) domain that is associated with susceptibility to nonarteritic anterior ischemic optic neuropathy. [provided by RefSeq, Oct 2013]

Research Articles on CD42b

Similar Products

Product Notes

The CD42b (Catalog #AAA6156974) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD42b (Platelet Glycoprotein Ib alpha Chain, GP-Ib alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Antigen CD42b-alpha, GP1BA, MGC34595) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD42b can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD42b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD42b, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.