Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CD3G Monoclonal Antibody | anti-CD3G antibody

CD3G (T-cell Surface Glycoprotein CD3 gamma Chain, T-cell Receptor T3 gamma Chain, CD3g, T3G) (AP)

Gene Names
CD3G; T3G; IMD17; CD3-GAMMA
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD3G; Monoclonal Antibody; CD3G (T-cell Surface Glycoprotein CD3 gamma Chain; T-cell Receptor T3 gamma Chain; CD3g; T3G) (AP); anti-CD3G antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A6
Specificity
Recognizes human CD3G.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CD3G antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-111 from human CD3G (NP_000064) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CD3G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
917
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13.1 kDa (117aa)
NCBI Official Full Name
T-cell surface glycoprotein CD3 gamma chain
NCBI Official Synonym Full Names
CD3g molecule
NCBI Official Symbol
CD3G
NCBI Official Synonym Symbols
T3G; IMD17; CD3-GAMMA
NCBI Protein Information
T-cell surface glycoprotein CD3 gamma chain
UniProt Protein Name
T-cell surface glycoprotein CD3 gamma chain
UniProt Gene Name
CD3G
UniProt Synonym Gene Names
T3G
UniProt Entry Name
CD3G_HUMAN

NCBI Description

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3G: The CD3 complex mediates signal transduction.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: T cell receptor complex; integral to plasma membrane; plasma membrane; alpha-beta T cell receptor complex

Molecular Function: receptor signaling complex scaffold activity; transmembrane receptor activity; protein heterodimerization activity; T cell receptor binding

Biological Process: protein transport; regulation of immune response; cell surface receptor linked signal transduction; T cell activation; T cell costimulation; establishment and/or maintenance of cell polarity; innate immune response; protein complex assembly; T cell receptor signaling pathway

Disease: Immunodeficiency 17

Research Articles on CD3G

Similar Products

Product Notes

The CD3G cd3g (Catalog #AAA6130456) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD3G (T-cell Surface Glycoprotein CD3 gamma Chain, T-cell Receptor T3 gamma Chain, CD3g, T3G) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD3G can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD3G cd3g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD3G, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.