Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human CD34 Monoclonal Antibody | anti-CD34 antibody

CD34 (Hematopoietic Progenitor Cell Antigen CD34, CD34 Molecule) (AP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD34; Monoclonal Antibody; CD34 (Hematopoietic Progenitor Cell Antigen CD34; CD34 Molecule) (AP); anti-CD34 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5F3
Specificity
Recognizes human CD34.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CD34 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa32-141 from human CD34 (NP_001764) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged CD34 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD34 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CD34 antibody
CD34 is thought to function as an adhesion molecule for early hematopoietic progenitors mediating the attachment of stem cells to extracellular matrix or stromal mucosialin. It is selectively expressed on majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, and embryonic fibroblasts. CD34+ hematopoietic progenitors may be mobilized to the peripheral blood by treatment with recombinant canine granulocyte colony-stimulating factor and stem-cell factor. Furthermore, CD34 is expressed on some canine leukemias.
Product Categories/Family for anti-CD34 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
947
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.6kDa (268aa) 40-57KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
hematopoietic progenitor cell antigen CD34 isoform b
NCBI Official Synonym Full Names
CD34 molecule
NCBI Official Symbol
CD34
NCBI Protein Information
hematopoietic progenitor cell antigen CD34
UniProt Protein Name
Hematopoietic progenitor cell antigen CD34
UniProt Gene Name
CD34
UniProt Entry Name
CD34_HUMAN

NCBI Description

The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

CD34: Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins. Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. Belongs to the CD34 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: intercellular bridge; lysosome; integral to plasma membrane; perinuclear region of cytoplasm; cytoplasm; apical plasma membrane; basal plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: sulfate binding; carbohydrate binding; transcription factor binding

Biological Process: positive regulation of odontogenesis; regulation of immune response; negative regulation of nitric oxide biosynthetic process; glomerular filtration; cell motility involved in cell locomotion; negative regulation of blood coagulation; negative regulation of tumor necrosis factor production; signal transduction; positive regulation of interleukin-10 production; cell proliferation; cell-cell adhesion; positive regulation of angiogenesis; endothelial cell proliferation; regulation of blood pressure; tissue homeostasis; hemopoiesis; leukocyte migration

Research Articles on CD34

Similar Products

Product Notes

The CD34 cd34 (Catalog #AAA6130451) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD34 (Hematopoietic Progenitor Cell Antigen CD34, CD34 Molecule) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD34 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD34 cd34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD34, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.