Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CD20 Monoclonal Antibody | anti-CD20 antibody

CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (MaxLight 650)

Gene Names
MS4A1; B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD20; Monoclonal Antibody; CD20 (B1; B-lymphocyte Antigen CD20; B-lymphocyte Surface Antigen B1; Bp35; CVID5; Leukocyte Surface Antigen Leu-16; LEU-16; Membrane-spanning 4-domains Subfamily A Member 1; MS4A1; MS4A2; MGC3969; S7) (MaxLight 650); anti-CD20 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C11
Specificity
Recognizes human MS4A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CD20 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa210-297 from human MS4A1 (AAH02807) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CD20 antibody
Members of MS4A protein family are characterized by the presence of 4 highly conserved transmembrane domains. CD20, a 35-37kD Human B-cell specific tetraspan membrane protein, is a unique member of this family. CD20 plays a major role in the initiation of intracellular signaling and regulating B-cell growth and differentiation. It complexes with BCR and regulates Calcium ion entry, thereby regulating B-cell signaling and activation. Antibodies such as Rituximab directed against CD20 are being extensively used for the treatment of B-cell lymphomas.
Product Categories/Family for anti-CD20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
931
Molecular Weight
14,581 Da
NCBI Official Full Name
Homo sapiens membrane-spanning 4-domains, subfamily A, member 1, mRNA
NCBI Official Synonym Full Names
membrane spanning 4-domains A1
NCBI Official Symbol
MS4A1
NCBI Official Synonym Symbols
B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16
NCBI Protein Information
B-lymphocyte antigen CD20
Protein Family

NCBI Description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008]

Research Articles on CD20

Similar Products

Product Notes

The CD20 (Catalog #AAA6221323) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD20 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.