Mouse anti-Human CD13 Monoclonal Antibody | anti-CD13 antibody

CD13 (Aminopeptidase N, AP-N, hAPN, Alanyl Aminopeptidase, Microsomal Aminopeptidase, Aminopeptidase M, AP-M, gp150, Myeloid Plasma Membrane Glycoprotein CD13, ANPEP, PEPN, APN) (Biotin)

Cat. Num. AAA6141030

• Gene Names: ANPEP; APN; CD13; LAP1; P150; PEPN; GP150
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD13; Monoclonal Antibody; CD13 (Aminopeptidase N; AP-N; hAPN; Alanyl Aminopeptidase; Microsomal Aminopeptidase; Aminopeptidase M; AP-M; gp150; Myeloid Plasma Membrane Glycoprotein CD13; ANPEP; PEPN; APN) (Biotin); anti-CD13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G1
• Specificity: Recognizes human ANPEP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 3541

• Applicable Applications for anti-CD13 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa858-967 from human ANPEP (AAH58928.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ANPEP is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-CD13 antibody

Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types, responsible for the processing of peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection.

Product Categories/Family for anti-CD13 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 37590639
• NCBI GeneID: 290
• NCBI Official Full Name: Homo sapiens alanyl (membrane) aminopeptidase, mRNA
• NCBI Official Synonym Full Names: alanyl aminopeptidase, membrane
• NCBI Official Symbol: ANPEP
• NCBI Official Synonym Symbols: APN; CD13; LAP1; P150; PEPN; GP150
• NCBI Protein Information: aminopeptidase N

NCBI Description

Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. This membrane-bound zinc metalloprotease is known to serve as a receptor for the HCoV-229E alphacoronavirus as well as other non-human coronaviruses. This gene has also been shown to promote angiogenesis, tumor growth, and metastasis and defects in this gene are associated with various types of leukemia and lymphoma. [provided by RefSeq, Apr 2020]