Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CD115 Monoclonal Antibody | anti-CD115 antibody

CD115 (Macrophage Colony-stimulating Factor 1 Receptor, CSF-1 Receptor, CSF-1-R, CSF-1R, M-CSF-R, Proto-oncogene c-Fms, CSF1R, FMS) (PE)

Gene Names
CSF1R; FMS; CSFR; FIM2; HDLS; C-FMS; CD115; CSF-1R; BANDDOS; M-CSF-R
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD115; Monoclonal Antibody; CD115 (Macrophage Colony-stimulating Factor 1 Receptor; CSF-1 Receptor; CSF-1-R; CSF-1R; M-CSF-R; Proto-oncogene c-Fms; CSF1R; FMS) (PE); anti-CD115 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G4
Specificity
Recognizes human CSF1R.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3904
Applicable Applications for anti-CD115 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-120 from human CSF1R (AAH47521) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(CSF1R monoclonal antibody. Western Blot analysis of CSF1R expression in human colon.)

Western Blot (WB) (CSF1R monoclonal antibody. Western Blot analysis of CSF1R expression in human colon.)

Testing Data

(Detection limit for recombinant GST tagged CSF1R is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSF1R is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GRAP2 and CSF1R. HeLa cells were stained with GRAP2 rabbit purified polyclonal 1:1200 and CSF1R mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GRAP2 and CSF1R. HeLa cells were stained with GRAP2 rabbit purified polyclonal 1:1200 and CSF1R mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-CD115 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens colony stimulating factor 1 receptor, mRNA
NCBI Official Synonym Full Names
colony stimulating factor 1 receptor
NCBI Official Symbol
CSF1R
NCBI Official Synonym Symbols
FMS; CSFR; FIM2; HDLS; C-FMS; CD115; CSF-1R; BANDDOS; M-CSF-R
NCBI Protein Information
macrophage colony-stimulating factor 1 receptor

NCBI Description

The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Alternative splicing results in multiple transcript variants. Expression of a splice variant from an LTR promoter has been found in Hodgkin lymphoma (HL), HL cell lines and anaplastic large cell lymphoma. [provided by RefSeq, Mar 2017]

Research Articles on CD115

Similar Products

Product Notes

The CD115 (Catalog #AAA6156936) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD115 (Macrophage Colony-stimulating Factor 1 Receptor, CSF-1 Receptor, CSF-1-R, CSF-1R, M-CSF-R, Proto-oncogene c-Fms, CSF1R, FMS) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD115 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD115 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD115, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.