Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CCL3 Monoclonal Antibody | anti-CCL3 antibody

CCL3 (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, G0S19-1, MIP1A, SCYA3) (MaxLight 550)

Gene Names
CCL3; MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL3; Monoclonal Antibody; CCL3 (C-C Motif Chemokine 3; G0/G1 Switch Regulatory Protein 19-1; Macrophage Inflammatory Protein 1-alpha; MIP-1-alpha; PAT 464.1; SIS-beta; Small-inducible Cytokine A3; Tonsillar Lymphocyte LD78 alpha Protein; G0S19-1; MIP1A; SCYA3) (MaxLight 550); anti-CCL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E7
Specificity
Recognizes human CCL3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CCL3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-93 from human CCL3 (NP_002974) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CCL3 antibody
Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Product Categories/Family for anti-CCL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10.0 kDa (90aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
NCBI Official Full Name
C-C motif chemokine 3
NCBI Official Synonym Full Names
C-C motif chemokine ligand 3
NCBI Official Symbol
CCL3
NCBI Official Synonym Symbols
MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
NCBI Protein Information
C-C motif chemokine 3
UniProt Protein Name
C-C motif chemokine 3
Protein Family
UniProt Gene Name
CCL3
UniProt Synonym Gene Names
G0S19-1; MIP1A; SCYA3; MIP-1-alpha
UniProt Entry Name
CCL3_HUMAN

NCBI Description

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]

Uniprot Description

CCL3: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Chemokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; cytoplasm; extracellular region; intracellular; cytosol

Molecular Function: identical protein binding; CCR1 chemokine receptor binding; protein binding; chemokine activity; calcium-dependent protein kinase C activity; kinase activity; CCR5 chemokine receptor binding; protein kinase activity; chemoattractant activity; phospholipase activator activity

Biological Process: positive regulation of catalytic activity; negative regulation of osteoclast differentiation; exocytosis; behavior; response to toxin; positive regulation of calcium-mediated signaling; positive regulation of interleukin-1 beta secretion; chemotaxis; protein amino acid phosphorylation; regulation of cell shape; monocyte chemotaxis; negative regulation of bone mineralization; cell-cell signaling; positive chemotaxis; positive regulation of neuron apoptosis; calcium ion transport; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; inflammatory response; lymphocyte chemotaxis; neutrophil chemotaxis; calcium-mediated signaling; MAPKKK cascade; cytoskeleton organization and biogenesis; release of sequestered calcium ion by sarcoplasmic reticulum into cytosol; positive regulation of tumor necrosis factor production; macrophage chemotaxis; cellular calcium ion homeostasis; osteoblast differentiation; positive regulation of protein kinase B signaling cascade; cell activation; eosinophil chemotaxis; eosinophil degranulation; regulation of sensory perception of pain; positive regulation of calcium ion transport; astrocyte cell migration; positive regulation of inflammatory response; positive regulation of cell migration

Disease: Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on CCL3

Similar Products

Product Notes

The CCL3 ccl3 (Catalog #AAA6210615) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCL3 (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, G0S19-1, MIP1A, SCYA3) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL3 ccl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.