Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CCL17 Monoclonal Antibody | anti-CCL17 antibody

CCL17 (SCYA17, TARC, C-C Motif Chemokine 17, CC Chemokine TARC, Small-inducible Cytokine A17, Thymus and Activation-regulated Chemokine, MGC138271, MGC138273) (MaxLight 650)

Gene Names
CCL17; TARC; ABCD-2; SCYA17; A-152E5.3
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL17; Monoclonal Antibody; CCL17 (SCYA17; TARC; C-C Motif Chemokine 17; CC Chemokine TARC; Small-inducible Cytokine A17; Thymus and Activation-regulated Chemokine; MGC138271; MGC138273) (MaxLight 650); anti-CCL17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F11
Specificity
Recognizes human CCL17.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CCL17 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-95 from human CCL17 (NP_002978) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CCL17 antibody
This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.
Product Categories/Family for anti-CCL17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10 kDa
NCBI Official Full Name
C-C motif chemokine 17
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 17
NCBI Official Symbol
CCL17
NCBI Official Synonym Symbols
TARC; ABCD-2; SCYA17; A-152E5.3
NCBI Protein Information
C-C motif chemokine 17; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17
UniProt Protein Name
C-C motif chemokine 17
Protein Family
UniProt Gene Name
CCL17
UniProt Synonym Gene Names
SCYA17; TARC
UniProt Entry Name
CCL17_HUMAN

NCBI Description

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL17: Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: extracellular space; extracellular region

Molecular Function: CCR4 chemokine receptor binding; chemokine activity; receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; multicellular organismal development; immune response; negative regulation of myoblast differentiation; inflammatory response; chemotaxis

Research Articles on CCL17

Similar Products

Product Notes

The CCL17 ccl17 (Catalog #AAA6221287) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCL17 (SCYA17, TARC, C-C Motif Chemokine 17, CC Chemokine TARC, Small-inducible Cytokine A17, Thymus and Activation-regulated Chemokine, MGC138271, MGC138273) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL17 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL17 ccl17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.