Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CCL1 is 1ng/ml as a capture antibody.)

Mouse anti-Human CCL1 Monoclonal Antibody | anti-CCL1 antibody

CCL1 (C-C Motif Chemokine 1, Small-inducible Cytokine A1, T Lymphocyte-secreted Protein I-309, SCYA1) (AP)

Gene Names
CCL1; P500; SISe; TCA3; I-309; SCYA1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL1; Monoclonal Antibody; CCL1 (C-C Motif Chemokine 1; Small-inducible Cytokine A1; T Lymphocyte-secreted Protein I-309; SCYA1) (AP); anti-CCL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E4
Specificity
Recognizes human CCL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CCL1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-97 from human CCL1 (NP_002972) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CCL1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CCL1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-CCL1 antibody
Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
Product Categories/Family for anti-CCL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10.8 kDa (94aa) confirmed by MALDI-TOF
NCBI Official Full Name
C-C motif chemokine 1
NCBI Official Synonym Full Names
C-C motif chemokine ligand 1
NCBI Official Symbol
CCL1
NCBI Official Synonym Symbols
P500; SISe; TCA3; I-309; SCYA1
NCBI Protein Information
C-C motif chemokine 1
UniProt Protein Name
C-C motif chemokine 1
Protein Family
UniProt Gene Name
CCL1
UniProt Synonym Gene Names
SCYA1
UniProt Entry Name
CCL1_HUMAN

NCBI Description

This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine (C-C motif) receptor 8. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL1: Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Chemokine; Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space

Molecular Function: chemokine activity

Biological Process: cellular calcium ion homeostasis; viral reproduction; immune response; signal transduction; chemotaxis

Research Articles on CCL1

Similar Products

Product Notes

The CCL1 ccl1 (Catalog #AAA6130395) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCL1 (C-C Motif Chemokine 1, Small-inducible Cytokine A1, T Lymphocyte-secreted Protein I-309, SCYA1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL1 ccl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.