Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CCDC5 Monoclonal Antibody | anti-CCDC5 antibody

CCDC5 (HAUS Augmin-like Complex Subunit 1, Coiled-coil Domain-containing Protein 5, Enhancer Of Invasion-Cluster, HEI-C, HAUS1, HEIC, FLJ21094, FLJ40084) (HRP)

Gene Names
HAUS1; HEIC; CCDC5; HEI-C; HsT1461
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCDC5; Monoclonal Antibody; CCDC5 (HAUS Augmin-like Complex Subunit 1; Coiled-coil Domain-containing Protein 5; Enhancer Of Invasion-Cluster; HEI-C; HAUS1; HEIC; FLJ21094; FLJ40084) (HRP); anti-CCDC5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E3
Specificity
Recognizes human CCDC5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CCDC5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa179-279 from human CCDC5 (NP_612452) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-CCDC5 antibody
CCDC5 is regulator of spindle function and integrity during the metaphase-anaphase transition.
Product Categories/Family for anti-CCDC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,744 Da
NCBI Official Full Name
HAUS augmin-like complex subunit 1
NCBI Official Synonym Full Names
HAUS augmin-like complex, subunit 1
NCBI Official Symbol
HAUS1
NCBI Official Synonym Symbols
HEIC; CCDC5; HEI-C; HsT1461
NCBI Protein Information
HAUS augmin-like complex subunit 1; coiled-coil domain containing 5 (spindle associated); coiled-coil domain-containing protein 5; enhancer of invasion-cluster
UniProt Protein Name
HAUS augmin-like complex subunit 1
UniProt Gene Name
HAUS1
UniProt Synonym Gene Names
CCDC5; HEIC; HEI-C
UniProt Entry Name
HAUS1_HUMAN

NCBI Description

HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).[supplied by OMIM, Jun 2010]

Uniprot Description

CCDC5: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex. Belongs to the HAUS1 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: spindle pole; centrosome; microtubule; cytoplasm

Molecular Function: protein binding

Biological Process: mitosis; cell division; centrosome organization and biogenesis; spindle assembly

Research Articles on CCDC5

Similar Products

Product Notes

The CCDC5 haus1 (Catalog #AAA6151605) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCDC5 (HAUS Augmin-like Complex Subunit 1, Coiled-coil Domain-containing Protein 5, Enhancer Of Invasion-Cluster, HEI-C, HAUS1, HEIC, FLJ21094, FLJ40084) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCDC5 haus1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCDC5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.