Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (56.21kD).)

Mouse anti-Human CBR1 Monoclonal Antibody | anti-CBR1 antibody

CBR1 (Carbonyl Reductase [NADPH] 1, NADPH-dependent Carbonyl Reductase 1, Prostaglandin-E(2) 9-reductase, Prostaglandin 9-ketoreductase, 15-hydroxyprostaglandin Dehydrogenase [NADP+], CBR, CRN) APC

Gene Names
CBR1; CBR; hCBR1; SDR21C1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CBR1; Monoclonal Antibody; CBR1 (Carbonyl Reductase [NADPH] 1; NADPH-dependent Carbonyl Reductase 1; Prostaglandin-E(2) 9-reductase; Prostaglandin 9-ketoreductase; 15-hydroxyprostaglandin Dehydrogenase [NADP+]; CBR; CRN) APC; anti-CBR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D12-1G8
Specificity
Recognizes human CBR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CBR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-277 from human CBR1 (AAH02511.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (56.21kD).)

Western Blot (WB)

(CBR1 monoclonal antibody, Western Blot analysis of CBR1 expression in Hela.)

Western Blot (WB) (CBR1 monoclonal antibody, Western Blot analysis of CBR1 expression in Hela.)
Related Product Information for anti-CBR1 antibody
Carbonyl reductase 1 (CBR1)is one of several monomeric,NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.
Product Categories/Family for anti-CBR1 antibody
References
1. Functional characterization of the promoter of human carbonyl reductase 1 (CBR1). Role of XRE elements in mediating induction of CBR1 by ligands of the aryl hydrocarbon receptor. Lakhman SS, Chen X, Gonzalez-Covarrubias V, Schuetz EG, Blanco JG.Mol Pharmacol. 2007 Sep;72(3):734-43. Epub 2007 Jun 14

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
873
Molecular Weight
18,762 Da
NCBI Official Full Name
Homo sapiens carbonyl reductase 1, mRNA
NCBI Official Synonym Full Names
carbonyl reductase 1
NCBI Official Symbol
CBR1
NCBI Official Synonym Symbols
CBR; hCBR1; SDR21C1
NCBI Protein Information
carbonyl reductase [NADPH] 1
Protein Family

NCBI Description

The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]

Research Articles on CBR1

Similar Products

Product Notes

The CBR1 (Catalog #AAA6135685) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CBR1 (Carbonyl Reductase [NADPH] 1, NADPH-dependent Carbonyl Reductase 1, Prostaglandin-E(2) 9-reductase, Prostaglandin 9-ketoreductase, 15-hydroxyprostaglandin Dehydrogenase [NADP+], CBR, CRN) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CBR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CBR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.