Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CAT Monoclonal Antibody | anti-CAT antibody

CAT (Catalase, MGC138422, MGC138424) (AP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAT; Monoclonal Antibody; CAT (Catalase; MGC138422; MGC138424) (AP); anti-CAT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G6
Specificity
Recognizes human CAT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CAT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human CAT (NP_001743) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CAT monoclonal antibody Western Blot analysis of CAT expression in HepG2.)

Western Blot (WB) (CAT monoclonal antibody Western Blot analysis of CAT expression in HepG2.)
Related Product Information for anti-CAT antibody
Catalase is known marker for peroxisomes. It is the most abundant protein in the peroxisomes. It is present in all aerobically respiring organisms. It protects cells form the toxicity of hydrogen peroxide.
Product Categories/Family for anti-CAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
847
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61.9 kDa (547aa)
NCBI Official Full Name
catalase
NCBI Official Synonym Full Names
catalase
NCBI Official Symbol
CAT
NCBI Protein Information
catalase
UniProt Protein Name
Catalase
Protein Family
UniProt Gene Name
CAT
UniProt Entry Name
CATA_HUMAN

NCBI Description

This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

Catalase: Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells including T-cells, B-cells, myeloid leukemia cells, melanoma cells, mastocytoma cells and normal and transformed fibroblast cells. Homotetramer. Belongs to the catalase family.

Protein type: Amino Acid Metabolism - tryptophan; Endoplasmic reticulum; EC 1.11.1.6; Apoptosis; Energy Metabolism - methane; Mitochondrial; Hydrolase; Oxidoreductase

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: peroxisomal membrane; Golgi apparatus; peroxisomal matrix; focal adhesion; intracellular membrane-bound organelle; membrane; endoplasmic reticulum; lysosome; plasma membrane; mitochondrial intermembrane space; peroxisome; cytosol

Molecular Function: antioxidant activity; oxidoreductase activity, acting on peroxide as acceptor; enzyme binding; protein homodimerization activity; catalase activity; metal ion binding; heme binding; NADP binding; aminoacylase activity; receptor binding

Biological Process: cholesterol metabolic process; hemoglobin metabolic process; nucleobase, nucleoside and nucleotide metabolic process; purine base metabolic process; activation of NF-kappaB transcription factor; protein homotetramerization; osteoblast differentiation; positive regulation of phosphoinositide 3-kinase cascade; response to vitamin E; response to reactive oxygen species; triacylglycerol metabolic process; response to hyperoxia; UV protection; hydrogen peroxide catabolic process; inhibition of NF-kappaB transcription factor; ureteric bud development; positive regulation of cell division; response to hypoxia; aerobic respiration; purine nucleotide catabolic process; protein tetramerization; negative regulation of apoptosis; aging

Disease: Acatalasemia

Research Articles on CAT

Similar Products

Product Notes

The CAT cat (Catalog #AAA6130375) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAT (Catalase, MGC138422, MGC138424) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAT cat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.