Mouse CAMKK2 Monoclonal Antibody | anti-CAMKK2 antibody

CAMKK2 (Calcium/Calmodulin-Dependent Protein Kinase Kinase 2, beta, CAMKK, CAMKKB, KIAA0787, MGC15254) (Biotin)

Cat. Num. AAA6171064

• Gene Names: CAMKK2; CAMKK; CAMKKB
• Applications: Western Blot
• Purity: Purified
• Synonyms: CAMKK2; Monoclonal Antibody; CAMKK2 (Calcium/Calmodulin-Dependent Protein Kinase Kinase 2; beta; CAMKK; CAMKKB; KIAA0787; MGC15254) (Biotin); Calcium/Calmodulin-Dependent Protein Kinase Kinase 2; MGC15254; anti-CAMKK2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4C7
• Specificity: Recognizes CAMKK2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 541

• Applicable Applications for anti-CAMKK2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CAMKK2 (AAH26060, 1aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CAMKK2 monoclonal antibody (M02), clone 4C7 Western Blot analysis of CAMKK2 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged CAMKK2 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-CAMKK2 antibody

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq]

Product Categories/Family for anti-CAMKK2 antibody

Antibodies; Protein Kinases

References

1. Regulation of Rac1 by simvastatin in endothelial cells: differential roles of AMP-activated protein kinase and calmodulin-dependent kinase kinase-beta. Kou R, Sartoretto J, Michel T.J Biol Chem. 2009 May 29;284(22):14734-43. Epub 2009 Mar 30.

NCBI and Uniprot Product Information

• NCBI GI #: 19913510
• NCBI GeneID: 10645
• NCBI Official Full Name: Calcium/calmodulin-dependent protein kinase kinase 2, beta
• NCBI Official Synonym Full Names: calcium/calmodulin dependent protein kinase kinase 2
• NCBI Official Symbol: CAMKK2
• NCBI Official Synonym Symbols: CAMKK; CAMKKB
• NCBI Protein Information: calcium/calmodulin-dependent protein kinase kinase 2
• Protein Family: Calcium/calmodulin-dependent protein kinase

NCBI Description

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012]