Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human Calnexin Monoclonal Antibody | anti-CANX antibody

Calnexin (CANX, CNX, FLJ26570, Histocompatibility Complex Class I Antigen Binding Protein p88, IP90, P90) APC

Gene Names
CANX; CNX; P90; IP90
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Calnexin; Monoclonal Antibody; Calnexin (CANX; CNX; FLJ26570; Histocompatibility Complex Class I Antigen Binding Protein p88; IP90; P90) APC; anti-CANX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D4
Specificity
Recognizes human CANX.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CANX antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa504-592 from human CANX (NP_001737.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CANX on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CANX on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CANX is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CANX is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX. HeLa cells were stained with CD3D rabbit purified polyclonal 1:1200 and CANX mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX. HeLa cells were stained with CD3D rabbit purified polyclonal 1:1200 and CANX mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-CANX antibody
References
1. The SARS Coronavirus E Protein Interacts with PALS1 and Alters Tight Junction Formation and Epithelial Morphogenesis. Teoh KT, Siu YL, Chan WL, Schluter MA, Liu CJ, Peiris JS, Bruzzone R, Margolis B, Nal B.Mol Biol Cell. 2010 Nov;21(22):3838-52. Epub 2010 Sep 22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
821
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,598 Da
NCBI Official Full Name
calnexin
NCBI Official Synonym Full Names
calnexin
NCBI Official Symbol
CANX
NCBI Official Synonym Symbols
CNX; P90; IP90
NCBI Protein Information
calnexin; major histocompatibility complex class I antigen-binding protein p88
UniProt Protein Name
Calnexin
Protein Family
UniProt Gene Name
CANX
UniProt Entry Name
CALX_HUMAN

NCBI Description

This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Calnexin: a calcium-binding protein of the calreticulin family. A type I membrane protein of the endoplasmic reticulum .Interacts with newly synthesized glycoproteins in the endoplasmic reticulum. May act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.

Protein type: Endoplasmic reticulum; Calcium-binding; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: dendrite cytoplasm; endoplasmic reticulum membrane; smooth endoplasmic reticulum; protein complex; rough endoplasmic reticulum; endoplasmic reticulum; endoplasmic reticulum lumen; dendritic spine; cell soma; membrane; axon; melanosome; ribosome

Molecular Function: ionotropic glutamate receptor binding; protein binding; unfolded protein binding; apolipoprotein binding; calcium ion binding; glycoprotein binding; carbohydrate binding

Biological Process: antigen processing and presentation of peptide antigen via MHC class I; cellular protein metabolic process; protein folding; synaptic vesicle endocytosis; protein secretion; antigen processing and presentation of exogenous peptide antigen via MHC class II; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; aging

Research Articles on CANX

Similar Products

Product Notes

The CANX canx (Catalog #AAA6135640) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Calnexin (CANX, CNX, FLJ26570, Histocompatibility Complex Class I Antigen Binding Protein p88, IP90, P90) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Calnexin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CANX canx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Calnexin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.