Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CALCOCO2 Monoclonal Antibody | anti-CALCOCO2 antibody

CALCOCO2 (Calcium-binding and Coiled-coil Domain-containing Protein 2, Antigen Nuclear Dot 52kD Protein, Nuclear Domain 10 Protein NDP52, Nuclear Domain 10 Protein 52, Nuclear Dot Protein 52, NDP52) (Biotin)

Gene Names
CALCOCO2; NDP52
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CALCOCO2; Monoclonal Antibody; CALCOCO2 (Calcium-binding and Coiled-coil Domain-containing Protein 2; Antigen Nuclear Dot 52kD Protein; Nuclear Domain 10 Protein NDP52; Nuclear Domain 10 Protein 52; Nuclear Dot Protein 52; NDP52) (Biotin); anti-CALCOCO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C4
Specificity
Recognizes human CALCOCO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CALCOCO2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa347-446 from CALCOCO2 (NP_005822) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged CALCOCO2 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CALCOCO2 is 1ng/ml as a capture antibody.)
Related Product Information for anti-CALCOCO2 antibody
CALCOCO2 is a subunit of nuclear domain 10 (ND10) bodies, which are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles. CALCOCO2 is part of a complex along with TAX1BP1 and MYO6. It also interacts with GEMIN4 and may play a role in ruffle formation and actin cytoskeleton organization.
Product Categories/Family for anti-CALCOCO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,669 Da
NCBI Official Full Name
calcium-binding and coiled-coil domain-containing protein 2 isoform 3
NCBI Official Synonym Full Names
calcium binding and coiled-coil domain 2
NCBI Official Symbol
CALCOCO2
NCBI Official Synonym Symbols
NDP52
NCBI Protein Information
calcium-binding and coiled-coil domain-containing protein 2
UniProt Protein Name
Calcium-binding and coiled-coil domain-containing protein 2
UniProt Gene Name
CALCOCO2
UniProt Synonym Gene Names
NDP52; Nuclear domain 10 protein 52
UniProt Entry Name
CACO2_HUMAN

NCBI Description

This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a receptor for ubiquitin-coated bacteria and plays an important role in innate immunity by mediating macroautophagy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]

Research Articles on CALCOCO2

Similar Products

Product Notes

The CALCOCO2 calcoco2 (Catalog #AAA6140936) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CALCOCO2 (Calcium-binding and Coiled-coil Domain-containing Protein 2, Antigen Nuclear Dot 52kD Protein, Nuclear Domain 10 Protein NDP52, Nuclear Domain 10 Protein 52, Nuclear Dot Protein 52, NDP52) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CALCOCO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CALCOCO2 calcoco2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CALCOCO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.