Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CALB1 expression in transfected 293T cell line using 244158 Lane 1: CALB1 transfected lysate (Predicted MW: 30 KD).Lane 2: Non-transfected lysate.)

Mouse CALB1 Monoclonal Antibody | anti-CALB1 antibody

CALB1 (calbindin 1, 28kD, CALB) (MaxLight 405)

Gene Names
CALB1; CALB
Applications
Western Blot
Purity
Purified
Synonyms
CALB1; Monoclonal Antibody; CALB1 (calbindin 1; 28kD; CALB) (MaxLight 405); calbindin 1; CALB; anti-CALB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F6
Specificity
Recognizes human CALB1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CALB1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-261 of human CALB1 (NP_004920.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CALB1 expression in transfected 293T cell line using 244158 Lane 1: CALB1 transfected lysate (Predicted MW: 30 KD).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CALB1 expression in transfected 293T cell line using 244158 Lane 1: CALB1 transfected lysate (Predicted MW: 30 KD).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CALB1 Using 244158 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CALB1 Using 244158 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CALB1 antibody
Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27-kD protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted. [provided by RefSeq]
Product Categories/Family for anti-CALB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
793
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
261
NCBI Official Full Name
calbindin
NCBI Official Synonym Full Names
calbindin 1, 28kDa
NCBI Official Symbol
CALB1
NCBI Official Synonym Symbols
CALB
NCBI Protein Information
calbindin; D-28K; calbindin D28; RTVL-H protein; calbindin 1, (28kD); vitamin D-dependent calcium-binding protein, avian-type
UniProt Protein Name
Calbindin
Protein Family
UniProt Gene Name
CALB1
UniProt Synonym Gene Names
CAB27
UniProt Entry Name
CALB1_HUMAN

Similar Products

Product Notes

The CALB1 calb1 (Catalog #AAA6194759) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CALB1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CALB1 calb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CALB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.