Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Cadherin E Monoclonal Antibody | anti-CDHE antibody

Cadherin E (Cadherin-1, CAM 120/80, Epithelial Cadherin, E-cadherin, Uvomorulin, CD324, CDH1, CDHE, UVO) (MaxLight 405)

Gene Names
CDH1; UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cadherin E; Monoclonal Antibody; Cadherin E (Cadherin-1; CAM 120/80; Epithelial Cadherin; E-cadherin; Uvomorulin; CD324; CDH1; CDHE; UVO) (MaxLight 405); anti-CDHE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F4
Specificity
Recognizes human CDH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CDHE antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.375ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa381-480 from human CDH1 (NP_004351) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CDHE antibody
References
1. Development of an AlphaLISA assay to quantify serum core-fucosylated E-cadherin as a metastatic lung adenocarcinoma biomarker. Wen CL, Chen KY, Chen CT, Chuang JG, Yang PC, Chow LP.J Proteomics. 2012 May 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
999
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76.6kDa (694aa) 70KDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
cadherin-1 isoform 1 preproprotein
NCBI Official Synonym Full Names
cadherin 1
NCBI Official Symbol
CDH1
NCBI Official Synonym Symbols
UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324
NCBI Protein Information
cadherin-1
UniProt Protein Name
Cadherin-1
UniProt Gene Name
CDH1
UniProt Synonym Gene Names
CDHE; UVO; E-cadherin
UniProt Entry Name
CADH1_HUMAN

NCBI Description

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16. [provided by RefSeq, Nov 2015]

Uniprot Description

CDH1: a single-pass type I membrane protein, and calcium dependent cell adhesion proteins. It is a ligand for integrin alpha-E/beta-7, and it colocalizes with DLG7 at sites of cell-cell contact in intestinal epithelial cells. Anchored to actin microfilaments through association with alpha-, beta- and gamma-catenin. Sequential proteolysis induced by apoptosis or calcium influx, results in translocation from sites of cell-cell contact to the cytoplasm. Involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Defects in CDH1 are involved in dysfunction of the cell-cell adhesion system, triggering cancer invasion (gastric, breast, ovary, endometrium and thyroid) and metastasis. Has a potent invasive suppressor role.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: apical junction complex; internal side of plasma membrane; focal adhesion; cell surface; lateral loop; basolateral plasma membrane; extracellular region; integral to membrane; trans-Golgi network; catenin complex; actin cytoskeleton; cell-cell adherens junction; apical part of cell; perinuclear region of cytoplasm; cytoplasm; plasma membrane; nerve terminal; cell junction; endosome; lateral plasma membrane

Molecular Function: protein domain specific binding; protein binding; gamma-catenin binding; beta-catenin binding; GTPase activating protein binding; calcium ion binding; cell adhesion molecule binding; ankyrin binding; glycoprotein binding; protein phosphatase binding

Biological Process: response to drug; intercellular junction assembly and maintenance; extracellular matrix organization and biogenesis; regulation of immune response; apoptosis; response to toxin; positive regulation of transcription, DNA-dependent; regulation of caspase activity; trophectodermal cell differentiation; regulation of water loss via skin; extracellular matrix disassembly; cell-cell adhesion; synaptogenesis; sensory perception of sound; pituitary gland development; calcium-dependent cell-cell adhesion; protein metabolic process; positive regulation of transcription factor import into nucleus; negative regulation of cell-cell adhesion; homophilic cell adhesion; protein homooligomerization; neurite development; negative regulation of epithelial cell proliferation; cell structure disassembly during apoptosis

Disease: Gastric Cancer, Hereditary Diffuse; Prostate Cancer; Breast Cancer; Ovarian Cancer; Endometrial Cancer

Research Articles on CDHE

Similar Products

Product Notes

The CDHE cdh1 (Catalog #AAA6189185) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cadherin E (Cadherin-1, CAM 120/80, Epithelial Cadherin, E-cadherin, Uvomorulin, CD324, CDH1, CDHE, UVO) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cadherin E can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.375ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDHE cdh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cadherin E, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.