Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)

Mouse anti-Human CACNG7 Monoclonal Antibody | anti-CACNG7 antibody

CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (Biotin)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CACNG7; Monoclonal Antibody; CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit; Neuronal Voltage-gated Calcium Channel gamma-7 Subunit; Transmembrane AMPAR Regulatory Protein gamma-7) (Biotin); anti-CACNG7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F7
Specificity
Recognizes human CACNG7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CACNG7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa203-275 from human CACNG7 (NP_114102) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.03kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)

Testing Data

(Detection limit for recombinant GST tagged CACNG7 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CACNG7 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-CACNG7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,003 Da
NCBI Official Full Name
voltage-dependent calcium channel gamma-7 subunit
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, gamma subunit 7
NCBI Official Symbol
CACNG7
NCBI Protein Information
voltage-dependent calcium channel gamma-7 subunit; TARP gamma-7; transmembrane AMPAR regulatory protein gamma-7; neuronal voltage-gated calcium channel gamma-7 subunit
UniProt Protein Name
Voltage-dependent calcium channel gamma-7 subunit
UniProt Gene Name
CACNG7
UniProt Synonym Gene Names
TARP gamma-7
UniProt Entry Name
CCG7_HUMAN

NCBI Description

The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit. [provided by RefSeq, Dec 2010]

Uniprot Description

CACNG7: Regulates the trafficking and gating properties of AMPA- selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity only for GRIA1 and GRIA2. Thought to stabilize the calcium channel in an inactivated (closed) state. Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.

Protein type: Channel, calcium; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: voltage-gated calcium channel complex

Molecular Function: voltage-gated calcium channel activity

Biological Process: calcium ion transport

Similar Products

Product Notes

The CACNG7 cacng7 (Catalog #AAA6140925) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CACNG7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CACNG7 cacng7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNG7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.