Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CACNB4 is 0.03 ng/ml as a capture antibody.)

Mouse CACNB4 Monoclonal Antibody | anti-CACNB4 antibody

CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit, CAB4, CACNLB4, EA5, EJM) (FITC)

Gene Names
CACNB4; EA5; EJM; CAB4; EIG9; EJM4; EJM6; CACNLB4
Applications
Western Blot
Purity
Purified
Synonyms
CACNB4; Monoclonal Antibody; CACNB4 (Calcium Channel; Voltage-Dependent; beta 4 Subunit; CAB4; CACNLB4; EA5; EJM) (FITC); Calcium Channel; EJM; anti-CACNB4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
70
Specificity
Recognizes CACNB4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CACNB4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CACNB4 (NP_000717.2, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDED
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CACNB4 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CACNB4 is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(CACNB4 monoclonal antibody (M01), clone 7E1. Western Blot analysis of CACNB4 expression in K-562.)

Western Blot (WB) (CACNB4 monoclonal antibody (M01), clone 7E1. Western Blot analysis of CACNB4 expression in K-562.)
Product Categories/Family for anti-CACNB4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
785
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
voltage-dependent L-type calcium channel subunit beta-4 isoform b
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, beta 4 subunit
NCBI Official Symbol
CACNB4
NCBI Official Synonym Symbols
EA5; EJM; CAB4; EIG9; EJM4; EJM6; CACNLB4
NCBI Protein Information
voltage-dependent L-type calcium channel subunit beta-4; calcium channel voltage-dependent subunit beta 4; dihydropyridine-sensitive L-type, calcium channel beta-4 subunit
UniProt Protein Name
Voltage-dependent L-type calcium channel subunit beta-4
UniProt Gene Name
CACNB4
UniProt Synonym Gene Names
CACNLB4; CAB4
UniProt Entry Name
CACB4_HUMAN

NCBI Description

This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Research Articles on CACNB4

Similar Products

Product Notes

The CACNB4 cacnb4 (Catalog #AAA6179012) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CACNB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CACNB4 cacnb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNB4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.