Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CACNB2 monoclonal antibody (M05), clone 6C4 Western Blot analysis of CACNB2 expression in Hela S3 NE.)

Mouse CACNB2 Monoclonal Antibody | anti-CACNB2 antibody

CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit, CACNLB2, CAVB2, FLJ23743, MYSB) (AP)

Gene Names
CACNB2; MYSB; CAVB2; CACNLB2
Applications
Western Blot
Purity
Purified
Synonyms
CACNB2; Monoclonal Antibody; CACNB2 (Calcium Channel; Voltage-Dependent; beta 2 Subunit; CACNLB2; CAVB2; FLJ23743; MYSB) (AP); Calcium Channel; MYSB; anti-CACNB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6C4
Specificity
Recognizes CACNB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CACNB2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CACNB2 (NP_963890, 213aa-301aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CACNB2 monoclonal antibody (M05), clone 6C4 Western Blot analysis of CACNB2 expression in Hela S3 NE.)

Western Blot (WB) (CACNB2 monoclonal antibody (M05), clone 6C4 Western Blot analysis of CACNB2 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(CACNB2 monoclonal antibody (M05), clone 6C4. Western Blot analysis of CACNB2 expression in NIH/3T3.)

Western Blot (WB) (CACNB2 monoclonal antibody (M05), clone 6C4. Western Blot analysis of CACNB2 expression in NIH/3T3.)
Related Product Information for anti-CACNB2 antibody
Mouse monoclonal antibody raised against a partial recombinant CACNB2.
Product Categories/Family for anti-CACNB2 antibody
References
1. Decrease in the density of t-tubular L-type Ca2+ channel currents in failing ventricular myocytes. Horiuchi-Hirose M, Kashihara T, Nakada T, Kurebayashi N, Shimojo H, Shibazaki T, Sheng X, Yano S, Hirose M, Hongo M, Sakurai T, Moriizumi T, Ueda H, Yamada M.Am J Physiol Heart Circ Physiol. 2011 Mar;300(3):H978-88. Epub 2010 Dec 30. 2. Role of glycine residues highly conserved in the S2-S3 linkers of domains I and II of voltage-gated calcium channel alpha1 subunits. Teng J, Iida K, Ito M, Izumi-Nakaseko H, Kojima I, Adachi-Akahane S, Iida H.BBA-Biomembranes (2010), doi: 10.1016/j.bbamem.2010.01.004.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
783
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
voltage-dependent L-type calcium channel subunit beta-2 isoform 2
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit beta 2
NCBI Official Symbol
CACNB2
NCBI Official Synonym Symbols
MYSB; CAVB2; CACNLB2
NCBI Protein Information
voltage-dependent L-type calcium channel subunit beta-2
UniProt Protein Name
Voltage-dependent L-type calcium channel subunit beta-2
UniProt Gene Name
CACNB2
UniProt Synonym Gene Names
CACNLB2; MYSB; CAB2; MYSB
UniProt Entry Name
CACB2_HUMAN

NCBI Description

This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmune disorder. Mutations in this gene are associated with Brugada syndrome. Alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Feb 2013]

Uniprot Description

CACNB2: The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRGDA4). A heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset. Belongs to the calcium channel beta subunit family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, calcium

Chromosomal Location of Human Ortholog: 10p12

Cellular Component: integral to plasma membrane; voltage-gated calcium channel complex; sarcolemma

Molecular Function: voltage-gated calcium channel activity; protein binding; calcium channel activity; high voltage-gated calcium channel activity

Biological Process: synaptic transmission; axon guidance; visual perception; transport; positive regulation of calcium ion transport; neuromuscular junction development

Disease: Brugada Syndrome 4

Research Articles on CACNB2

Similar Products

Product Notes

The CACNB2 cacnb2 (Catalog #AAA6161536) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CACNB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CACNB2 cacnb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.