Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human CACNA2D2 Monoclonal Antibody | anti-CACNA2D2 antibody

CACNA2D2 (KIAA0558, Voltage-dependent Calcium Channel Subunit alpha-2/delta-2, Voltage-gated Calcium Channel Subunit alpha-2/delta-2) APC

Gene Names
CACNA2D2; CASVDD; CACNA2D
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CACNA2D2; Monoclonal Antibody; CACNA2D2 (KIAA0558; Voltage-dependent Calcium Channel Subunit alpha-2/delta-2; Voltage-gated Calcium Channel Subunit alpha-2/delta-2) APC; anti-CACNA2D2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A4
Specificity
Recognizes human CACNA2D2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
5696
Applicable Applications for anti-CACNA2D2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa65-162 from CACNA2D2 (NP_006021) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CACNA2D2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CACNA2D2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CACNA2D2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CACNA2D2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-CACNA2D2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens calcium voltage-gated channel auxiliary subunit alpha2delta 2 (CACNA2D2), transcript variant 2, mRNA
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit alpha2delta 2
NCBI Official Symbol
CACNA2D2
NCBI Official Synonym Symbols
CASVDD; CACNA2D
NCBI Protein Information
voltage-dependent calcium channel subunit alpha-2/delta-2
UniProt Protein Name
Voltage-dependent calcium channel subunit alpha-2/delta-2
UniProt Gene Name
CACNA2D2
UniProt Synonym Gene Names
KIAA0558
UniProt Entry Name
CA2D2_HUMAN

NCBI Description

Calcium channels mediate the entry of calcium ions into the cell upon membrane polarization. This gene encodes the alpha-2/delta subunit of the voltage-dependent calcium channel complex. The complex consists of the main channel-forming subunit alpha-1, and auxiliary subunits alpha-2/delta, beta, and gamma. The auxiliary subunits function in the assembly and membrane localization of the complex, and modulate calcium currents and channel activation/inactivation kinetics. The subunit encoded by this gene undergoes post-translational cleavage to yield the extracellular alpha2 peptide and a membrane-anchored delta polypeptide. This subunit is a receptor for the antiepileptic drug, gabapentin. Mutations in this gene are associated with early infantile epileptic encephalopathy. Single nucleotide polymorphisms in this gene are correlated with increased sensitivity to opioid drugs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]

Uniprot Description

CACNA2D2: The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) and possibly T-type (CACNA1G). Overexpression induces apoptosis. Belongs to the calcium channel subunit alpha-2/delta family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: plasma membrane; voltage-gated calcium channel complex

Molecular Function: voltage-gated calcium channel activity; metal ion binding

Biological Process: rhythmic synaptic transmission; energy reserve metabolic process; regulation of multicellular organism growth; muscle fiber development; positive regulation of organ growth; regulation of insulin secretion; neuromuscular junction development

Research Articles on CACNA2D2

Similar Products

Product Notes

The CACNA2D2 cacna2d2 (Catalog #AAA6135618) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CACNA2D2 (KIAA0558, Voltage-dependent Calcium Channel Subunit alpha-2/delta-2, Voltage-gated Calcium Channel Subunit alpha-2/delta-2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CACNA2D2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CACNA2D2 cacna2d2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNA2D2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.