Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human CABC1 Monoclonal Antibody | anti-ADCK3 antibody

CABC1 (Chaperone-activity of bc1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, MGC4849, PP265)

Gene Names
ADCK3; COQ8; ARCA2; CABC1; SCAR9; COQ10D4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Ascites
Synonyms
CABC1; Monoclonal Antibody; CABC1 (Chaperone-activity of bc1 Complex-like; Mitochondrial; Chaperone-ABC1-like; aarF Domain-containing Protein Kinase 3; ADCK3; MGC4849; PP265); Anti -CABC1 (Chaperone-activity of bc1 Complex-like; anti-ADCK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
1C12
Specificity
Recognizes human CABC1.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD
Applicable Applications for anti-ADCK3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-100 from human CABC1 (AAH05171) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(CABC1 monoclonal antibody, Western Blot analysis of CABC1 expression in HeLa NE.)

Western Blot (WB) (CABC1 monoclonal antibody, Western Blot analysis of CABC1 expression in HeLa NE.)
Related Product Information for anti-ADCK3 antibody
May be a chaperone-like protein essential for the proper conformation and functioning of protein complexes in the respiratory chain.
Product Categories/Family for anti-ADCK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,950 Da
NCBI Official Full Name
chaperone activity of bc1 complex-like, mitochondrial
NCBI Official Synonym Full Names
aarF domain containing kinase 3
NCBI Official Symbol
ADCK3
NCBI Official Synonym Symbols
COQ8; ARCA2; CABC1; SCAR9; COQ10D4
NCBI Protein Information
chaperone activity of bc1 complex-like, mitochondrial; coenzyme Q8 homolog; aarF domain-containing protein kinase 3; chaperone, ABC1 activity of bc1 complex homolog
UniProt Protein Name
Chaperone activity of bc1 complex-like, mitochondrial
UniProt Gene Name
ADCK3
UniProt Synonym Gene Names
CABC1; Chaperone-ABC1-like
UniProt Entry Name
ADCK3_HUMAN

NCBI Description

This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May be a chaperone-like protein essential for the proper conformation and functioning of protein complexes in the respiratory chain.

Subcellular location: Mitochondrion Ref.1.

Tissue specificity: Ubiquitously expressed with a relatively greater abundance in heart and skeletal muscle.

Induction: By p53/TP53.

Involvement in disease: Coenzyme Q10 deficiency, primary, 4 (COQ10D4) [MIM:612016]: An autosomal recessive disorder characterized by childhood-onset of cerebellar ataxia and exercise intolerance. Patient manifest gait ataxia and cerebellar atrophy with slow progression. Additional features include brisk tendon reflexes and Hoffmann sign, variable psychomotor retardation and variable seizures.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10 Ref.11

Sequence similarities: Belongs to the protein kinase superfamily. ADCK protein kinase family.Contains 1 protein kinase domain.

Caution: It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).

Research Articles on ADCK3

Similar Products

Product Notes

The ADCK3 adck3 (Catalog #AAA647308) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CABC1 (Chaperone-activity of bc1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, MGC4849, PP265) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CABC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ADCK3 adck3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAILGDTIM VAKGLVKLTQ AAVETHLQHL GIGGELIMAA RALQSTAVEQ IGMFLGKVQG QDKHEEYFAE NFGGPEGEFH FSVPHAAGAS TDFSSASAPD. It is sometimes possible for the material contained within the vial of "CABC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.