Testing Data
(Detection limit for recombinant GST tagged CA5B is 0.1ng/ml as a capture antibody.)
Mouse anti-Human CA5B Monoclonal Antibody | anti-CA5B antibody
CA5B (Carbonic Anhydrase 5B, Mitochondrial, Carbonate Dehydratase VB, Carbonic Anhydrase VB, MGC39962) (AP)
Gene Names
CA5B; CA-VB
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CA5B; Monoclonal Antibody; CA5B (Carbonic Anhydrase 5B; Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; MGC39962) (AP); anti-CA5B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E12
Specificity
Recognizes human CA5B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CA5B antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-318 from CA5B (AAH28142) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged CA5B is 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CA5B is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-CA5B antibody
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles.
Product Categories/Family for anti-CA5B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
36,434 Da
NCBI Official Full Name
Homo sapiens carbonic anhydrase VB, mitochondrial, mRNA
NCBI Official Synonym Full Names
carbonic anhydrase 5B
NCBI Official Symbol
CA5B
NCBI Official Synonym Symbols
CA-VB
NCBI Protein Information
carbonic anhydrase 5B, mitochondrial
Protein Family
NCBI Description
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles. [provided by RefSeq, Jul 2008]
Research Articles on CA5B
Similar Products
Product Notes
The CA5B (Catalog #AAA6130305) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CA5B (Carbonic Anhydrase 5B, Mitochondrial, Carbonate Dehydratase VB, Carbonic Anhydrase VB, MGC39962) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CA5B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CA5B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CA5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
