Testing Data
(Immunoperoxidase of monoclonal antibody to C6orf199 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)
Mouse anti-Human C6orf199 Monoclonal Antibody | anti-C6orf199 antibody
C6orf199 (AKD1, AKD2, C6orf199, C6orf224, Adenylate Kinase Domain-containing Protein 1, Adenylate Kinase Domain-containing Protein 2, FLJ42177, MGC26954, RP1-70A9.1, DJ70A9.1) (AP)
Gene Names
AK9; AK 9; AKD1; AKD2; C6orf199; C6orf224; dJ70A9.1
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C6orf199; Monoclonal Antibody; C6orf199 (AKD1; AKD2; C6orf224; Adenylate Kinase Domain-containing Protein 1; Adenylate Kinase Domain-containing Protein 2; FLJ42177; MGC26954; RP1-70A9.1; DJ70A9.1) (AP); anti-C6orf199 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H8
Specificity
Recognizes human C6orf199.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-C6orf199 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa321-422 from human C6orf199 (NP_659462) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Immunoperoxidase of monoclonal antibody to C6orf199 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)
Testing Data
(Immunoperoxidase of monoclonal antibody to C6orf199 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged C6orf199 is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged C6orf199 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-C6orf199 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
adenylate kinase 9 isoform 2
NCBI Official Synonym Full Names
adenylate kinase 9
NCBI Official Symbol
AK9
NCBI Official Synonym Symbols
AK 9; AKD1; AKD2; C6orf199; C6orf224; dJ70A9.1
NCBI Protein Information
adenylate kinase 9
UniProt Protein Name
Adenylate kinase 9
UniProt Gene Name
AK9
UniProt Synonym Gene Names
AKD1; AKD2; C6orf199; C6orf224; AK 9
UniProt Entry Name
KAD9_HUMAN
NCBI Description
The protein encoded by this gene catalyzes the interconversion of nucleosides, possessing both nucleoside monophosphate and diphosphate kinase activities. The encoded protein uses these interconversions to maintain nucleoside homeostasis. [provided by RefSeq, Jul 2016]
Research Articles on C6orf199
Similar Products
Product Notes
The C6orf199 ak9 (Catalog #AAA6130293) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C6orf199 (AKD1, AKD2, C6orf199, C6orf224, Adenylate Kinase Domain-containing Protein 1, Adenylate Kinase Domain-containing Protein 2, FLJ42177, MGC26954, RP1-70A9.1, DJ70A9.1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C6orf199 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C6orf199 ak9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C6orf199, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
