Western Blot (WB)
(Western Blot analysis of VSTM2L expression in transfected 293T cell line by C20orf102 monoclonal antibody (M02), clone 1A8.Lane 1: VSTM2L transfected lysate (22.3 KDa).Lane 2: Non-transfected lysate.)
Mouse C20orf102 Monoclonal Antibody | anti-C20orf102 antibody
C20orf102 (V-set and Transmembrane Domain Containing 2 like, C20orf102, dJ1118M15.2) (PE)
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
C20orf102; Monoclonal Antibody; C20orf102 (V-set and Transmembrane Domain Containing 2 like; dJ1118M15.2) (PE); V-set and Transmembrane Domain Containing 2 like; dJ1118M15.2; anti-C20orf102 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A8
Specificity
Recognizes C20orf102.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
204
Applicable Applications for anti-C20orf102 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
C20orf102 (AAH33818.1, 25aa-204aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of VSTM2L expression in transfected 293T cell line by C20orf102 monoclonal antibody (M02), clone 1A8.Lane 1: VSTM2L transfected lysate (22.3 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of VSTM2L expression in transfected 293T cell line by C20orf102 monoclonal antibody (M02), clone 1A8.Lane 1: VSTM2L transfected lysate (22.3 KDa).Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of VSTM2L transfected lysate using anti-VSTM2L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VSTM2L MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of VSTM2L transfected lysate using anti-VSTM2L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VSTM2L MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-C20orf102 antibody
Mouse monoclonal antibody raised against a full-length recombinant C20orf102.
Product Categories/Family for anti-C20orf102 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
V-set and transmembrane domain containing 2 like
Similar Products
Product Notes
The C20orf102 (Catalog #AAA6186118) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C20orf102 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C20orf102 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C20orf102, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
