Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human C1orf19 Monoclonal Antibody | anti-C1orf19 antibody

C1orf19 (Chromosome 1 Open Reading Frame 19, tRNA-splicing Endonuclease Subunit Sen15, SEN15 Homolog, HsSEN15, tRNA-intron Endonuclease Sen15, TSEN15, SEN15) (MaxLight 750)

Gene Names
TSEN15; PCH2F; sen15; C1orf19
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C1orf19; Monoclonal Antibody; C1orf19 (Chromosome 1 Open Reading Frame 19; tRNA-splicing Endonuclease Subunit Sen15; SEN15 Homolog; HsSEN15; tRNA-intron Endonuclease Sen15; TSEN15; SEN15) (MaxLight 750); anti-C1orf19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8C7
Specificity
Recognizes human C1orf19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-C1orf19 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa72-171 from human C1orf19 (NP_443197) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLR
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-C1orf19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.9kDa (191aa), confirmed by MALDI-TOF
NCBI Official Full Name
tRNA-splicing endonuclease subunit Sen15 isoform 1
NCBI Official Synonym Full Names
tRNA splicing endonuclease subunit 15
NCBI Official Symbol
TSEN15
NCBI Official Synonym Symbols
PCH2F; sen15; C1orf19
NCBI Protein Information
tRNA-splicing endonuclease subunit Sen15
UniProt Protein Name
tRNA-splicing endonuclease subunit Sen15
UniProt Gene Name
TSEN15
UniProt Synonym Gene Names
C1orf19; SEN15; HsSEN15
UniProt Entry Name
SEN15_HUMAN

NCBI Description

This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by RefSeq, Jul 2014]

Uniprot Description

TSEN15: Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3' end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3' end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events. Belongs to the SEN15 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: nucleolus

Molecular Function: tRNA-intron endonuclease activity

Biological Process: tRNA splicing; mRNA processing

Research Articles on C1orf19

Similar Products

Product Notes

The C1orf19 tsen15 (Catalog #AAA6231840) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C1orf19 (Chromosome 1 Open Reading Frame 19, tRNA-splicing Endonuclease Subunit Sen15, SEN15 Homolog, HsSEN15, tRNA-intron Endonuclease Sen15, TSEN15, SEN15) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C1orf19 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C1orf19 tsen15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C1orf19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.