Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human C1GALT1 Monoclonal Antibody | anti-C1GALT1 antibody

C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, B3Gal-T8, Core 1 O-glycan T-synthase, Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1, Beta-1,3-galactosyltransferase, Core 1 beta1,3-galactosy

Gene Names
C1GALT1; C1GALT; T-synthase
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C1GALT1; Monoclonal Antibody; C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1; B3Gal-T8; Core 1 O-glycan T-synthase; Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1; 3-galactosyltransferase 1; Beta-1; 3-galactosyltransferase; Core 1 beta1; 3-galactosy; anti-C1GALT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F1
Specificity
Recognizes human C1GALT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-C1GALT1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa264-364 from human C1GALT1 (NP_064541) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(C1GALT1 monoclonal antibody, Western Blot analysis of C1GALT1 expression in HeLa.)

Western Blot (WB) (C1GALT1 monoclonal antibody, Western Blot analysis of C1GALT1 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to C1GALT1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to C1GALT1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged C1GALT1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C1GALT1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-C1GALT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.4 kDa (357aa), confirmed by MALDI-TOF
NCBI Official Full Name
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
NCBI Official Synonym Full Names
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
NCBI Official Symbol
C1GALT1
NCBI Official Synonym Symbols
C1GALT; T-synthase
NCBI Protein Information
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
UniProt Protein Name
Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
UniProt Gene Name
C1GALT1
UniProt Synonym Gene Names
Beta-1,3-galactosyltransferase; C1GalT1; Core 1 beta3-Gal-T1
UniProt Entry Name
C1GLT_HUMAN

NCBI Description

The protein encoded by this gene generates the common core 1 O-glycan structure, Gal-beta-1-3GalNAc-R, by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R. Core 1 is a precursor for many extended mucin-type O-glycans on cell surface and secreted glycoproteins. Studies in mice suggest that this gene plays a key role in thrombopoiesis and kidney homeostasis.[provided by RefSeq, Sep 2010]

Uniprot Description

C1GALT1: Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development. Belongs to the glycosyltransferase 31 family. Beta3- Gal-T subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.4.1.122; Glycan Metabolism - O-glycan biosynthesis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p21.3

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: protein binding; metal ion binding; glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activity

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; angiogenesis; kidney development; post-translational protein modification

Research Articles on C1GALT1

Similar Products

Product Notes

The C1GALT1 c1galt1 (Catalog #AAA6135579) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, B3Gal-T8, Core 1 O-glycan T-synthase, Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1, Beta-1,3-galactosyltransferase, Core 1 beta1,3-galactosy reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C1GALT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C1GALT1 c1galt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C1GALT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.